Cherry SNP DataBase

Gene information

Gene Pav_sc0000143.1_g550.1.mk
Chromosome name PAV_r1.0chr2
start 20970357
end 20975168
PAV_r1.0 name Pav_sc0000143.1
start 306509
end 311320
direction +
Annotation NR PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase mbk-2-like
Sequence CDS ATGGCGGTCTCAGCAGACGTCGATGCAGTGCTACAATTCTTGAGGAAAAACGGGCTTTCA GATGCAGAGTCGGCTCTCAAAGAGGATATGATTGAAAAAGGCGATCTGGGTTGTCTCGAT TACGAGAAATTCTTGTTTCCGATGGTGCCTCCGCCGCCTCCGGTTAGAATCCCGGCGAGT TTCCGGCGATCAGAGGTTCCAGGCGGCGGAGAATGCTCGAGATCGAGTTCGCAGGAAGAC GATGAGTTTGTGAGCATGGGGTCTTCTACTTCTAATATGTGCTCATCATCAGAATTTACA AATCCGTATGGAATTCGATCAACATCTCCAAGTGGTTCCAAAGCCTCATCTGATAGATTC TCTCAATTTGGCACTGCCCGTGATTACCATGATTTTGATATGCAAAATGACCTGTTCTGG CACGATGAGAAAGATGATGGAGACTTCATGACTCCTTGCTTTGAAGGGCCAGACTTCTTT GCCTGTCCCAGTGAGGATAAGTACATCATGACTTCGGACACCGACAAGCAAAACGAGAAC CTTCCGGGTCTGAATTTTAAATCTGAAGCATTTCAATCAGATATAAGCCTCGATTACTTG GACAAGAATTGTCTTACTAATATTTCTCCCGTGGATGATAAAAGTGAGCTTTATGTAACA GATCATTATAATTTTGATAAGAAAAATAACCTTGAAGGAGGCTTTGAGGAGGAGCCTGAG GGACGTGCTCCTCCTGCTTCTTCAGTCCACCTTTACAATTGCTGTGTTGGAGCTGAAGGA TTTTATGGTGAACATCCTGCAGATTGCTGCTACCGGAGCTCAAAAGAAACTGATTTCAAT AATTGCCAATTAAAGGTTTTGGGGGACATTCCTCCCACTGACATTGTTTCTGCTCCAAAT CATAGAATAAGCAAGAGTTCTAAAAATGACCAGGTTGAAAACTTTAAAGGCTCCTCTGGT TTAGATGGTAAGGTTGTAGAGAAAGATTTCATGCAAAAAGGAATTGATGGCTATGGAGTT GGAGACAGTGAAGTAAATGAAGAACCTTGTGAGCCTGAGGCTGCTGCTGATGGAGATGGT GTTGACGCTGATGAGGTTCTGATGTACAATGCTAACGAGGATGAATATGAAGTTTTTGAA TTAAGAATCATACACAGAAAGAACAGGACTGGATTTGAAGAAAACAAGGATTTCCCCATT GTGCTAAAGACCGTAATTGCAAGCAGATACTACATAACAGAATATCTTGGTTCGGCAGCT TTCAGTAAGGTTGTACAGGCTCATGATCTTCACACAGGAGTCGATGTTTGCCTTAAGATC ATAAAAAATGATAAAGAGTTTTTCGATCAGAGTTTGGATGAGATTAAACTTCTAAAGTTT GTCAACAAAAATGACCCTGGAGATGAACACCACATTCTGCGATTGTACGACTACTTCTAT CATCAGGAGCATCTCTTCATTGTTTGTGAACTCCTTCGGGCAAACTTGTACGAGTTTCAG AAGTTCAGTCAAGAATCTGGCGGAGAAGCTTACTTCACAATAAGAAGAGCTCCTGAAGTC ATTCTTGGCCTCCCTTATGACGAGAAGATTGACATGTGGTCTTTGGGCTGTATCTTGGCT GAGCTATGCTCTGGGGAAGTGCTCTTTCCAAATGATGCGATTGTAATGATCCTTGCACGT ATGATTGGAATGCTTGGTCCTATTGATCTGGATATGTTAGTGAGAGGTCAGGAGACAGAC AAGTACTTCACAAACGAGTTAGATCTTTACCACATAAATGAGTATGTGCAATCTCGTTCC TACAGAGCTCCTGAAGTCATTCTTGGCCTCCCTTATGACGAGAAGATTGACATGTGGTCA TTGGGCTGTATCTTGGCTGAGCTATGCTCTGGGGAAGTGCTCTTTCCAAATGATGCGATT GTAATGATCCTTGCACGTATGATTGGAATGCTTGGTCCTATTGATCTGGATATGTTAGTG AGAGGTCAGGAGACAGACAAGTACTTCACAAACGAGTTAGATCTTTACCACATAAATGAG GAGACAAGCCAACTGGAATATATAATCCCTGAGGAGTCCTCCTTGGAGAATCACCTGCAA GTAACCGATGTCGGGTTTATCGACTTTGTTAAAAGCTTGGTTGAGGTCAATCCCGAGAGA CGCCCAACGGCGAGGGAGGCAATGGAGCATCCATGGCTTTCCTACACGTACGAATCGAGT CCTTTCTAA
PEP MAVSADVDAVLQFLRKNGLSDAESALKEDMIEKGDLGCLDYEKFLFPMVPPPPPVRIPAS FRRSEVPGGGECSRSSSQEDDEFVSMGSSTSNMCSSSEFTNPYGIRSTSPSGSKASSDRF SQFGTARDYHDFDMQNDLFWHDEKDDGDFMTPCFEGPDFFACPSEDKYIMTSDTDKQNEN LPGLNFKSEAFQSDISLDYLDKNCLTNISPVDDKSELYVTDHYNFDKKNNLEGGFEEEPE GRAPPASSVHLYNCCVGAEGFYGEHPADCCYRSSKETDFNNCQLKVLGDIPPTDIVSAPN HRISKSSKNDQVENFKGSSGLDGKVVEKDFMQKGIDGYGVGDSEVNEEPCEPEAAADGDG VDADEVLMYNANEDEYEVFELRIIHRKNRTGFEENKDFPIVLKTVIASRYYITEYLGSAA FSKVVQAHDLHTGVDVCLKIIKNDKEFFDQSLDEIKLLKFVNKNDPGDEHHILRLYDYFY HQEHLFIVCELLRANLYEFQKFSQESGGEAYFTIRRAPEVILGLPYDEKIDMWSLGCILA ELCSGEVLFPNDAIVMILARMIGMLGPIDLDMLVRGQETDKYFTNELDLYHINEYVQSRS YRAPEVILGLPYDEKIDMWSLGCILAELCSGEVLFPNDAIVMILARMIGMLGPIDLDMLV RGQETDKYFTNELDLYHINEETSQLEYIIPEESSLENHLQVTDVGFIDFVKSLVEVNPER RPTAREAMEHPWLSYTYESSPF


| Top |