Cherry SNP DataBase

Gene information

Gene Pav_sc0000144.1_g240.1.br
Chromosome name PAV_r1.0chr8
start 1705119
end 1706964
PAV_r1.0 name Pav_sc0000144.1
start 106608
end 108453
direction +
Annotation NR PREDICTED: GDSL esterase/lipase At5g37690
Sequence CDS ATGGAGAAAGATGGAGAACAAGCACGATGGCTCCTTGCCAATTATGACCCTGGAGTTTTG CAAAATATTGAGTTTTTTTTTTTGGTTCTACCACTGATTCAGAGATTGTCCTTTGATGAT CAAATACAAAATTTCAACAAGACAAAGGAAGCCATCAAGGCTAAGATTGGGGGAGAGGCT GCAGCCAAGGTTTGCAGTGAAGCCGTCTACTTGATTGGAATTGGCAGCAATGATTATGTC AACAATTACTTGCAACCCTTTTTAGCTGATGGTCAGCAGTACACTTACGATGAATTTGTG GAACTATTAATCACCACATTAGAGGGGCAATTTACGGTTAGTAATATTTCTCTTCTTTCT GAGTTTCTGGTTTATGTTTACAACATTCCACATTTTGGAGAACCATAA
PEP MEKDGEQARWLLANYDPGVLQNIEFFFLVLPLIQRLSFDDQIQNFNKTKEAIKAKIGGEA AAKVCSEAVYLIGIGSNDYVNNYLQPFLADGQQYTYDEFVELLITTLEGQFTVSNISLLS EFLVYVYNIPHFGEP


| Top |