Cherry SNP DataBase

Gene information

Gene Pav_sc0000148.1_g180.1.mk
Chromosome name PAV_r1.0chr2
start 4530137
end 4530958
PAV_r1.0 name Pav_sc0000148.1
start 81976
end 82797
direction -
Annotation NR hypothetical protein PRUPE_ppa015501mg
Sequence CDS ATGTTGTCCATTAAACCACCAATCACTGATTTTGCCCTCAAGGCAAGGCTTCTACCAGCT ACGTCTCCCGGCACCCCGGAATTCGCAAACCTTCTGAGTAGTTTGAAAGGCGACCTCCGA TTATTTGTTGGACTAGAGTGGATTTTTGTTATCGCATTCTGTTTTTCCTCTTTGTTCTTT GCAACAGCTTCAATCTTAGCATCGGCAGTAACCTATTGTGGGAAAGACATGTCTATCAAG GAACTTCTATCAAGGGCCGTGAAATCATTGAAAAGACCGTTTCTTACTTGGTTTTACATA ACCCTTCTTCGTCTGGGCTATTATCTATTTCTCATAGCCTTTCTGGTTTCTTTGGTGCTG ATTTTCGATCTTACGTTCACTGAGCCTTCTTTATCATCTATAATCATATTGCTCCCAGCT ATAGTTTTCGAAGCTTATCTAGCTGTTGTTTGGAATTTAGCACTCGTTGTTTCGGTACTC GAAGAAAAGTGTGGAATTGAGGCACTTGGGAAGGCTGGACAGCTCATCAAAGGATTGAGG ATGCGCGGACTTTTCCTAAATCTTTTGTTTGTAGCACTCTCATATCCTGTGTCCCATGGT GTGCACAAGTATGGCAAAACAGTCATGTCATCAAATGCTGCCATGATTCCATTGCTCCTC CTGAATTCAATATCCTGCCTGATCATACTGTTTAATCTCATGGCATACACAGTCCTCTAT CACGATTGCAAGGCAACTCATGGAGAAGAACTTGAAATGCAAGGAGGCACTGAAAATACT AAAGTGGCCTTTACCCCACTTGTCAGTGCAGATTTACCATGA
PEP MLSIKPPITDFALKARLLPATSPGTPEFANLLSSLKGDLRLFVGLEWIFVIAFCFSSLFF ATASILASAVTYCGKDMSIKELLSRAVKSLKRPFLTWFYITLLRLGYYLFLIAFLVSLVL IFDLTFTEPSLSSIIILLPAIVFEAYLAVVWNLALVVSVLEEKCGIEALGKAGQLIKGLR MRGLFLNLLFVALSYPVSHGVHKYGKTVMSSNAAMIPLLLLNSISCLIILFNLMAYTVLY HDCKATHGEELEMQGGTENTKVAFTPLVSADLP


| Top |