Cherry SNP DataBase

Gene information

Gene Pav_sc0000158.1_g220.1.mk
Chromosome name PAV_r1.0chr3
start 897591
end 903019
PAV_r1.0 name Pav_sc0000158.1
start 116665
end 122093
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103327444 isoform X1
Sequence CDS ATGTCACTCGCAGCAACAACAGCGATGACGATGACGACATGTCGTTTCTTTAAGGTCAAA ATTCAATGCTCTGATTCGAAGCCCAGAACTGGTTTCGGAACCAAAACCAACATTAAGAAC AAGAACAGGAACAAGGTTTCGGAACCAAAACCAACAATAAGAACAAGAACAGGAACAAGA ACAACCTCAATCAGGAATCAACCACTAAACGGTCTGGTGCTGTTCCTACCCGTCACATTG TTGTTTGTAGAGGCACCTGGATTGAATTCTAGATTTGATGGAAAGGTTCAGAGAAACCCT GCTGACCTTGAGTTTGAGGAACGTCTGCAAGCAGTCAGAAGTTCAGCATTTGAGCAGAAA AAAGTGGTGGAAAAAAAGGAATTTGGGGCAATTGACTATGATGCACCTGTTGAGTTGGAG AAGAAGGAGAAGAAATCAATTGGACTTGGTACACAGATTGGAGTAGGTGTAGCTGTAGTA GTCTTCGGTTTGGTTTTTGCTCTTGGAGATTTTCTTCCTTCCGGAAGTTTAAGTCCTACT GAGGATGCTGCAGTAACCAGTAACAAACTGTCCGAAGAAGAGAAAGTGTCACTTCAGACT CGGCTGAAAGAATATGAAGCAACGCTTAGTAACTCCCCGAAGGATCCAACTGCTCTTGAG GGAGCTGCAGTAACCTTGGCAGAATTAGGAGAATATACTCGGGCTTCAACTCTGCTTCAG GACTTGGCTAAGGAGAAACCAAGTGATCCCGAAGTTTTTCGTTTGCTTGGAGAAGTTAAA TATGAACTCAAGGATTATGAAGGGAGTGCTGCTGCATATAAGGTTTCTTCAATGGTGTCT AAAGATCTCAAATTTGAAGTTCTGCGTGGCCTTACGAATTCATTACTTGCTGCTAAAAAA CCAGATGAGGCTGTTCAGTTTCTTCTTGCCTCTCGTGAACGTATGAATGCTGGCAATCCA GATGCAAAGGCTGGAAGCACTACAACTGAAACAAATTTGCAGGTGGACCCTATTCAAGTT GAATTACTTCTTGGAAAAGCATATTCAGATTGGGGTCATGTAAGTGATGCTGTATCTGTC TATGATCGGCTCATCTCTAGTCATCCAAATGACTTCCGTGGTTACTTGGCTAAGGGAATT ATTTTGAGAGAAAATGGTAAAGTTGGAGAAGCGGAGAGGATGTTTATACAGGCACGGTTT TTTGCACCAGATAAAGCCAAGGCACTTGTAGATCGATATTCAAGATAA
PEP MSLAATTAMTMTTCRFFKVKIQCSDSKPRTGFGTKTNIKNKNRNKVSEPKPTIRTRTGTR TTSIRNQPLNGLVLFLPVTLLFVEAPGLNSRFDGKVQRNPADLEFEERLQAVRSSAFEQK KVVEKKEFGAIDYDAPVELEKKEKKSIGLGTQIGVGVAVVVFGLVFALGDFLPSGSLSPT EDAAVTSNKLSEEEKVSLQTRLKEYEATLSNSPKDPTALEGAAVTLAELGEYTRASTLLQ DLAKEKPSDPEVFRLLGEVKYELKDYEGSAAAYKVSSMVSKDLKFEVLRGLTNSLLAAKK PDEAVQFLLASRERMNAGNPDAKAGSTTTETNLQVDPIQVELLLGKAYSDWGHVSDAVSV YDRLISSHPNDFRGYLAKGIILRENGKVGEAERMFIQARFFAPDKAKALVDRYSR


| Top |