Cherry SNP DataBase

Gene information

Gene Pav_sc0000164.1_g170.1.mk
Chromosome name PAV_r1.0chr8
start 17231262
end 17235061
PAV_r1.0 name Pav_sc0000164.1
start 90272
end 94071
direction -
Annotation NR PREDICTED: protein LOW PSII ACCUMULATION 1, chloroplastic
Sequence CDS ATGGCTTCTGTGGCAAACGGTCCCTTCTACATTCTCAAACCTCCAAACCATCCTGGTTAC AAACTCAGTAGTGGTATCAGAACGACCCTCTGGTCATTCTCATGTACCAATGCACCATTT CTCACACTGCAGACCTCAAAGCACAAGTCTTCAACCATCATTTGCTTTGCAACTGATAAG CAAACTTCTTCTACGGAAACCAGTTCCACAGCCCGGATTAGGAGTGAAGTTCTCACTCCC TTTCGCTCCGTTCGGATGTTTTTCTATCTTGCTTTCATAGCAAGTGGTGGTTTAGGAGGA CTCATAGCAACCACACAGTTAATTGCAGCACTAACAAACCCATCAAGAGCACTTGATGCC CCTGAAATTGTGAAGGGTCTTGGGATAGACCTTGGAGCAGTGTCTCTCTTTGCATTCTTG TATTTGAGAGAGAACAAGGCCAAGAATGCACAGATTGCTAGGCTCTCAAGAGAGGAAAAC CTTTCGAATCTTAAGCTCCGGGTTGATGAAAAGAAGGTCATTCCTCTTAGCTCTTTGAGA GGGATTGCTCGGCTTGTAATATGTGCAGGCCCTGCATCAGTCATCACAGAAGCTTTTAAT CAAAGTGAACCCTACACTGAAAGGCTTGTGGAACGAGGGGTGCTCGTGGTGCCCTTTCCT ACAGATGGAAACTTACCTAGTTTTGAGTTTGAAGAAAGTGAAGAGACTAAGGAGATTACT GCAAAGAGGAAAAGACTATGGCAGCTGACACCAATTTATATTCCTGAATGGACCAAGTGG TTAGATGAGCAAAAGAAGCTGGCAGGCGTCTCCTCTGAATCTCCTGTGTGGTTAGATGAG CAAAAGAAGCTGGCAGGCGTCTCCTCTGACTCTCCTGTGTATATATCTCTTCGCCTGGAT GGTCGTGTTCGTGGCAGTGGCATTGGTTACCCGCCTTGGAATGCTTTTGTTGCACAGTTA CCACCTGTGAAGGGAATGTGGTCTGGTCTTCTTGATGGGTTTGATGGAAGAGTTTAA
PEP MASVANGPFYILKPPNHPGYKLSSGIRTTLWSFSCTNAPFLTLQTSKHKSSTIICFATDK QTSSTETSSTARIRSEVLTPFRSVRMFFYLAFIASGGLGGLIATTQLIAALTNPSRALDA PEIVKGLGIDLGAVSLFAFLYLRENKAKNAQIARLSREENLSNLKLRVDEKKVIPLSSLR GIARLVICAGPASVITEAFNQSEPYTERLVERGVLVVPFPTDGNLPSFEFEESEETKEIT AKRKRLWQLTPIYIPEWTKWLDEQKKLAGVSSESPVWLDEQKKLAGVSSDSPVYISLRLD GRVRGSGIGYPPWNAFVAQLPPVKGMWSGLLDGFDGRV


| Top |