Cherry SNP DataBase

Gene information

Gene Pav_sc0000168.1_g110.1.mk
Chromosome name PAV_r1.0chr6
start 10024054
end 10025497
PAV_r1.0 name Pav_sc0000168.1
start 53361
end 54804
direction -
Annotation NR PREDICTED: NAC domain-containing protein 90
Sequence CDS ATGGCGGAGCTGCCACCAGGTTATCGCTTCTACCCAACGGAAGAAGAACTGGTCTCCTTC TACCTCCCCAACAAGCTCCAAGGGAAGCGAGACGATACTCGTCGCGTAATCCCAGTCGTA GACATTTACAGCCAAGAGCCATGGGACCTTCCAAAGTTTTCAGGGGAGTTGTGCCATGGA GACACAGAGCAATGGTTTTTCTTCACACCAAGACAACAAAGAGAAGCCCAAGGAGGAAGG CCCAACAGGACCACAGCTTCTGGGTACTGGAAGGCCACAGGCTCTCCTGGGTATGTTTAC TCCTCAGATAACAAGGTCATTGGACTGAAGAAAACCATGGTTTTCTATAAAGGCAAAGCT CCAACTGGAAGGAAAACCAAATGGAAGATGAATGAGTACAGAGCCATTGAAGCAGATAAC CCAACTACCACTACCACTAGTACTAGTTTCCCCAAGTACTTGAGGAATGAATTCAGATTG TGCCGGGTGTACGTGGTATCTGGGAGTTGTCGAGCATTTGACAGACGACCATTAGAAGGA GGTGGAGAGACGAAGCATCAATTGGGTGAGTCTATGGGTGGAACAAGCACCTTTTCTCTG AAGGCTCCAATGGTGGAGAAAGCAAGCTCATCGGATGAAACTTATTCATATTCAGGAGAG CTTGCTGATCTCCCAGAGACGTCTGCAGGGATTAATTGTATTAATTGGGAGATTATTGAA GGTTTTGAACAACCTCTATGGGAATGGGAACAATTGAATTTGCTTTAA
PEP MAELPPGYRFYPTEEELVSFYLPNKLQGKRDDTRRVIPVVDIYSQEPWDLPKFSGELCHG DTEQWFFFTPRQQREAQGGRPNRTTASGYWKATGSPGYVYSSDNKVIGLKKTMVFYKGKA PTGRKTKWKMNEYRAIEADNPTTTTTSTSFPKYLRNEFRLCRVYVVSGSCRAFDRRPLEG GGETKHQLGESMGGTSTFSLKAPMVEKASSSDETYSYSGELADLPETSAGINCINWEIIE GFEQPLWEWEQLNLL


| Top |