Cherry SNP DataBase

Gene information

Gene Pav_sc0000169.1_g030.1.mk
Chromosome name PAV_r1.0chr4
start 27263823
end 27268751
PAV_r1.0 name Pav_sc0000169.1
start 11182
end 16110
direction -
Annotation NR PREDICTED: chloride channel protein CLC-c-like
Sequence CDS ATGGGCAATGTTGTGGATTTTATCTGCATAACTGAATACGTGTTGTCTTTACTGGAAAAC TTCAGGTGGCGGAGTGCTCTTCTTTGGAGGACATTTTTCACAACAGCAGTTGTCGCCATA GTATTGAGAGTCTTTATACAATATTGTACTACCGGAAACTGTGGGCTATTTGGGCAAGGA GGTCTTATCATGTATGATGTCAGTGCAGCCAGTGCAACATACAGTGGTCCTGATATACTA GCAGTATTATTCCTAGGAATTCTTGGAGGAATTTTTGGAAGCATGTATAACTATCTCGTG GATAAGGTCATTCGAACTTATAGCATCATTCATGAAAAGGGTGCTGCGGCCAAAATCTTA CTTGTTATCACCATTGCTCTCTTGACATCATGTCTTTCTTATGGCTTACCATGGTTTGCG GAGTGCCAAGCATGCCCTACTGATGAGAGTGTGAGTTGTCCTACTGTTGGTCAATCTGGT AACTATAAAAGCTTCAATTGCCCATCAGGCTATTACAATGACCTTGCCTCCCTATTTCTA AACACTAATGATGATGCCATTCGTAATCTATTCAGCACCAGTACAACAAAAGAATTTCAC ATTTCCTCTCTTTTTATCTTCTTTGCTGCTGTTTACTTCCTTGGAATTATCACTTACGGC ATTGCTATTCCCTCTGGGCTCTTCATCCCTGTCATATTAGCTGGAGCTTGCTATGGACGT CTTGTTGGGAGGTTGTTTGAATCAATCTCTACTCTTGACACAGGTCTCTTTGCCCTACTT GGAGCTGCCTCCTTCCTGGGTGGCACTATGAGAATGACAGTCTCCCTATGTATTATACTG CTTGAACTCACCAATGACTTACTTTTGCTTCCCCTCGTCATGTTGGTTCTCCTTATTTCG AAAACTGTGGCTGATAACTTCAACAAGGGTATTTATGACCAAATAGTTAAAATAAAGGGA TTGCCTTATTTGGAGGCTCATGCAGAACCATACATGAGGCATTTGGTCACAAGTGATGTT GTTTCTGGTCCATTGGTTACTTTTTCTGGTATTGAGAAGGTTGGACGCATATTGGATGCT TTGAGGACTACAGGGCATAACGGATTCCCAGTGATTGATGAACCACCTTTTTCAGACGCT CCAGAATTGTGTGGTCTGGTTTTAAGGTCTCATTTGCTTATTTTGCTTAAGGGTAAGAAT TTTTCGACGGACAGGGTTGTTTGTGGAGCAGAGATCTTACACAGATTTGCTGCATTTGAT TTCGCTAAGGCAGGATCAGGAAAGGGAATCAAATTGGAGGATCTTGATATCGAAGAGGAG GAGATGGATATGTATATTGATCTCCATCCTATTACAAATGCATCGCCGTACACAGTCGTT GAGACAATGTCACTAGCCAAGGCTGCTATTCTCTTTCGGCAACTTGGTCTAAGACACCTG TGTTTGGTACCAAAGAGCCAAGGGAGACCTCCAATCGTCGGAATTCTAACACGGCATGAC TTCATGCCGGAGCACATTTTGGGACTCTACCCACATATCAAGGCTCACTAG
PEP MGNVVDFICITEYVLSLLENFRWRSALLWRTFFTTAVVAIVLRVFIQYCTTGNCGLFGQG GLIMYDVSAASATYSGPDILAVLFLGILGGIFGSMYNYLVDKVIRTYSIIHEKGAAAKIL LVITIALLTSCLSYGLPWFAECQACPTDESVSCPTVGQSGNYKSFNCPSGYYNDLASLFL NTNDDAIRNLFSTSTTKEFHISSLFIFFAAVYFLGIITYGIAIPSGLFIPVILAGACYGR LVGRLFESISTLDTGLFALLGAASFLGGTMRMTVSLCIILLELTNDLLLLPLVMLVLLIS KTVADNFNKGIYDQIVKIKGLPYLEAHAEPYMRHLVTSDVVSGPLVTFSGIEKVGRILDA LRTTGHNGFPVIDEPPFSDAPELCGLVLRSHLLILLKGKNFSTDRVVCGAEILHRFAAFD FAKAGSGKGIKLEDLDIEEEEMDMYIDLHPITNASPYTVVETMSLAKAAILFRQLGLRHL CLVPKSQGRPPIVGILTRHDFMPEHILGLYPHIKAH


| Top |