Cherry SNP DataBase

Gene information

Gene Pav_sc0000170.1_g150.1.mk
Chromosome name PAV_r1.0chr2
start 2285502
end 2288132
PAV_r1.0 name Pav_sc0000170.1
start 94806
end 97436
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103342793
Sequence CDS ATGGTACCGCTCTCCAACTTGAGGAGCCTCAGATTGGGTTATTTACTATTTCCTTCTAAA TTTGCTTCCAGAACTGAAATATTGATTGCCGGAGATCTAAAACCCTCACATTTTTCTCTT CAAAATCGGATACTCTGTAGACAGTTCACCTCAGAAATCTCAGAAGACCAACGCAGTTTC ACCGTCAATTACCTCATAACCTCATGTGGGTTGTCGCCAGAAGATGCGATTTCAACATCC AAAAGGATCAAGTTGCAGTCCCCAGAAAAAGCAGACTCCGTTTTGGGACTTCTAAGAAAC CATGGATTCTCTCAAACCCAGATCTCAAAGTTTTGCAAAACTCGCCCACAACTTCTTTTA GCCAGCCCTGAGCAAACCCTTTTGCCAAAGCTTGAGTTTTTCAGCTCTCTTGGAGTTTCA AGGGAGGACCTCGCAAAAACGCTGGTTCTGAATCCAAGTCTTTTGCAAAGAAGCTTGGAG AAACAGCTTCTGCCCACTTATAATTTCCTGAGGAGTCTGCTTCCTGAGAAAAATATCGTT TCTGTTTTCAAGTACAACTCGTCGATTTTCTTGCAAGCCCACACCAAGAAAGTAGTGCCA AATATCGTGATTTTGAGAGAATTAGGTATGCCTGAATCATGCATTTCTCTGTTGTTAGCT CATTGTACGCATGCTTTGATACATGATACTGAAAAGCTTCGCCAAGTTGTGAAAGAGGTT AAGGAAATGGGTTTTAACCTGGAAAAGTCGATTTCCGTGTTGGCAATAAGCATAATGTGT CGTTCATTTTATAAGCAGATATTGAAGCGAAATTGTGAAGTTTATAGCAGGTGGGGTTGG TCGGAGGCTGATGTTCTCTCTGCTTTCAGGAGGCGCCCGGAGTGTATTTCTCTGTCAGAG AAGAAAATAATGCAAACAATGGATCTGTTAGTGAACAAGATGGGATGGTCGTCAGAAATA ATTCTCAAGTCCCCATATGTTTTGAATTATAGTTTGAAGAAGAGAACCATCCCGAGGTGT TCGGTTGTTAGAGTTTTGTTGTCGAAAGGATTGATAAATACTGAAAAACTGAGCTTACAT TCTGTGTTTGGACCTGTGGAGAAGGAGTTCTTGGAGAGATTTATTGACAGATATCTGGGT GAAGTACCTCAGTTGTTGTGTGTATACCAAGGAAAAGTGGATATCCAGGACGTATGA
PEP MVPLSNLRSLRLGYLLFPSKFASRTEILIAGDLKPSHFSLQNRILCRQFTSEISEDQRSF TVNYLITSCGLSPEDAISTSKRIKLQSPEKADSVLGLLRNHGFSQTQISKFCKTRPQLLL ASPEQTLLPKLEFFSSLGVSREDLAKTLVLNPSLLQRSLEKQLLPTYNFLRSLLPEKNIV SVFKYNSSIFLQAHTKKVVPNIVILRELGMPESCISLLLAHCTHALIHDTEKLRQVVKEV KEMGFNLEKSISVLAISIMCRSFYKQILKRNCEVYSRWGWSEADVLSAFRRRPECISLSE KKIMQTMDLLVNKMGWSSEIILKSPYVLNYSLKKRTIPRCSVVRVLLSKGLINTEKLSLH SVFGPVEKEFLERFIDRYLGEVPQLLCVYQGKVDIQDV


| Top |