Cherry SNP DataBase

Gene information

Gene Pav_sc0000174.1_g1850.1.br
Chromosome name PAV_r1.0chr2
start 9288430
end 9290420
PAV_r1.0 name Pav_sc0000174.1
start 955893
end 957883
direction +
Annotation NR PREDICTED: major allergen Pru ar 1-like
Sequence CDS ATGGGTGTCTTCACATACGAAACCGAATTCACCTCAGTCGTTCCTCCTGCTAGGTTGTTC AAAGCCCTTGTTCTAGATGCTGACAACCTAGTCCCAAAGATTGCCCCACAAGCAATTAAA AGTGCTGAAATTATTGAAGGAGATGGAGGTGTTGGAACCATCAAGAAGACTAGCTTCGGT GAAGGAAGTGAATACAGCTACATGAAGCACCAGGTTGATGCGCTTGACAAAGATAACTTT GTGTACAGCTACAGTTTGATTGAAGGAGATGCTCTTTCAGACAAAATAGAGAAAATCTCT TATGAGATTAAGTTGGTGGCATCTGCAGACGGAGGTTCCATCATAAAGAACACCAGCAGC TACCACACCAAAGGTGATGTTGAGAGCATGTTAAAGCCGGCAAAGAGAAGGCCCAAGCTT TGTTCAAGATTATTGAGACCTATCTTGTGGCCAACCCTGATGCCTACAACTAAACCCATC TATAGGGGCAACAGTCTTGTGTCCTGTTTTCTCTGTTTCTTCAGCAATGTGGCTTTCAAT TCTTTTTCTTCTCTAGCATACCAAAGCATGCAGGTCTCTGACTTGCATGCACTTTTGGAG TTAAGATTGAAGACAATGGCGACGGTGGTGAAGCCAATGGTGGTGATGGCAATGGTGGTT TATGGGGGACGTAGTGGTGGAGGGGTAAGGGTAAGGGTAGTGGAGGTGGTGGCGGTGGCA GTGATGGTGATGGGGCTGATAGTGAGGGTGGTAGTGGTGGTGGAGGTAGGGTTGGGGCGG CGATGGGTGGTAGTGGAGGTGGAGGTGATGGTGGTGGTGGTGCTAGGGGGTGGCGGCAAT GGCGGTGGTGGTGGCAGCGACGACGATGATGATGACTGTGGTGGTAGTGGTGATGATGAT AGTCATGATAAAATGGTGGTAGTAGAAGTGGTGAAATCATATCTTGAGAATAAAAATAAT ATATGTATCAAAATCTCTGGGGTGAAGCAAAGATTTGTCATGGCCTAA
PEP MGVFTYETEFTSVVPPARLFKALVLDADNLVPKIAPQAIKSAEIIEGDGGVGTIKKTSFG EGSEYSYMKHQVDALDKDNFVYSYSLIEGDALSDKIEKISYEIKLVASADGGSIIKNTSS YHTKGDVESMLKPAKRRPKLCSRLLRPILWPTLMPTTKPIYRGNSLVSCFLCFFSNVAFN SFSSLAYQSMQVSDLHALLELRLKTMATVVKPMVVMAMVVYGGRSGGGVRVRVVEVVAVA VMVMGLIVRVVVVVEVGLGRRWVVVEVEVMVVVVLGGGGNGGGGGSDDDDDDCGGSGDDD SHDKMVVVEVVKSYLENKNNICIKISGVKQRFVMA


| Top |