Cherry SNP DataBase

Gene information

Gene Pav_sc0000174.1_g300.1.mk
Chromosome name PAV_r1.0chr2
start 8528529
end 8533230
PAV_r1.0 name Pav_sc0000174.1
start 195992
end 200693
direction +
Annotation NR PREDICTED: UDP-glucuronic acid decarboxylase 2-like
Sequence CDS ATGATCAGCTCCGATAACCAGTCTTTAGTTCACAGAACCCACACAACCCAATCTCATCAG CAAGATGAACAACCCGACCAATCATCACAACCCACCATTGATTTTGATCCTCAAAACAAT TGCAGGCCTCCCCATACAAACCCACTTCGCTATTTGCTTCGCGAGCAGCGCCTCGTCTTC CTCCTCATTGGCATCACCATAGCCACCCTCTTCTTCAGCAGCTTCCCCTTATCAAACCCG GAATTGGTGACGACCCACGACCCGGGTTTTGAATCCGGATCGGGTCTCGATCTCCCGGCC AACCCGACCCGGAGGGTACTCTACGAGGCCCGGGGTGTTGGGTTTGGGTCTGTGATGAGC GCGGGCGGGAAGGTGCCGCTGGGGTTGAAGAAGAAGAACCAGAGGATTGTGGTGACCGGT GGGGCCGGGTTCGTGGGGAGCCACCTCGTGGACCGTGTAAGGAGCTGTTACGATGAAGGA AAACGCACAGCAGAGACTCTCACCATGGATTACCATAGAGGCCTTGGCATTGAGGTGAGA ATTGCTCGGATTTTCAATACTTATGGACCACGTATGTGTATCGATGATGGTCGTGTTGTT AGCAATTTCGTAGCTCAGGCACTAAGGAAGGAGCCATTGACAGTTTACGGTGATGGCAAG CAAACCAGAAGTTTCCAATACGTTTCTGACTTGGTTGAGGGTCTAATGCGGCTGATGGAA GGAAATCATGTGGGCCCTTTCAATCTTGGCAACCCTGGTGAATTCACCATGCTAGAACTT GCTCAGGTTGTACAAGACACTATAGATCCAAATGCAAAGATAGAGTTCAGGCCCAACACA GAAGACGACCCACATAAAAGGAAGCCAGACATTTCAAAGGCTAAGGAGCTTCTCGGGTGG GAGCCTAATGTGTCCCTCCGCAAGGGGCTTCCTCTTATGGTCGCCGACTTTAGACACCGT ATATTTGGTGACCCAAGAGACAATCAAGGAGGCTCTACAACCTTCGCTTGA
PEP MISSDNQSLVHRTHTTQSHQQDEQPDQSSQPTIDFDPQNNCRPPHTNPLRYLLREQRLVF LLIGITIATLFFSSFPLSNPELVTTHDPGFESGSGLDLPANPTRRVLYEARGVGFGSVMS AGGKVPLGLKKKNQRIVVTGGAGFVGSHLVDRVRSCYDEGKRTAETLTMDYHRGLGIEVR IARIFNTYGPRMCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLME GNHVGPFNLGNPGEFTMLELAQVVQDTIDPNAKIEFRPNTEDDPHKRKPDISKAKELLGW EPNVSLRKGLPLMVADFRHRIFGDPRDNQGGSTTFA


| Top |