Cherry SNP DataBase

Gene information

Gene Pav_sc0000183.1_g360.1.br
Chromosome name PAV_r1.0chr3
start 6018436
end 6019297
PAV_r1.0 name Pav_sc0000183.1
start 149982
end 150843
direction -
Annotation NR PREDICTED: zinc finger MYM-type protein 1-like
Sequence CDS ATGGAAAGATTCTATAAGAGAAAGTTCTCATCAACTACTTCTAGTTCGGATAATGTGGAT AGTTCAGACTCAAGAGATGTGGGTAGTTCGAAAGAAAGTGAGTTACAAGATCTTATGAAT AATCTTCCTGCAGACCCTGGACTTCGACCTCAAATGTTGGATTATGATCATAACATTCGA AACGAAGACGATCTGGAATATCTGGGGAAGGTAGTGGCTGGTTCCATTGTGGCTGCAGCT GTTATAAAGTATGGAAGCATAGGTTTTCCTGAGATAACCAGACCCAACTCCTGTCATTGT AGCCATTTTATTTTTGATCAAGCAGAGCCATGCATGCAGAGGGGCGAAGCTAGGATAGGA AAACCCTCGTGA
PEP MERFYKRKFSSTTSSSDNVDSSDSRDVGSSKESELQDLMNNLPADPGLRPQMLDYDHNIR NEDDLEYLGKVVAGSIVAAAVIKYGSIGFPEITRPNSCHCSHFIFDQAEPCMQRGEARIG KPS


| Top |