Cherry SNP DataBase

Gene information

Gene Pav_sc0000183.1_g470.1.mk
Chromosome name PAV_r1.0chr3
start 6056732
end 6058941
PAV_r1.0 name Pav_sc0000183.1
start 188278
end 190487
direction +
Annotation NR PREDICTED: aspartate, glycine, lysine and serine-rich protein-like
Sequence CDS ATGCTTCTTAGAAGCTCCTCAGCTCCGCTCTTGAACTCATGGCTTTCCCACTCAAAAGAC TTCTCACCAGAGCCAGAGTCACTCCTCACTAGAACCAGGTCAGTTTCCTTATCATCATTT TCTTCTTTTCACTCACCTTCAATCGACTCAACAAAGAAAACAACAACCCAAATCTTGTTA GAAGCAGACATCCCAAGCCAACCTAAGCCCAAAAAGAAGAACCCCATACCTCTAAGCCTT GGAAAGAAATCTAAAACCAAGGCCAAAAATGTTGAAGAACAAGAAGAAGAGCTAAAACCC AGCTCAATATCTTCATCTGCGACCCAAAGGCTGTTCTCAAGCTCTGGTTTGGGTGTGAAG CTCATGGAAGATGAAGACTCTGCTGTGGGGAAAGAAGACGATGGTTTGCAGACACTAGTT TTGGGTGGTGGTGCGGGAAGTAATGGTGGTAAGATATGTGGTGGTGGTGGTAGTGGGAAA GGACCGGACGGTGGAGATGGAGGGGGTTCTGGTTTCTTTGAGAGTAACAATCATGGGAGT GGGAGCACAGATGCTTATTATCAGAAGATGATTCAAGCTGACCCGGGAAATTGCCTCTTA CTTGGGAACTATGCAAAGTTTCTAAAAGAGGTCCGAGGAGATTATGCTAAAGCAGAGGAG TACTGTGGAAGAGCGATTTTGGCGAACCCAAATGATGCCAATGTCTTATCACTATATGCT GATATAATATGGAAAACACAGAAGGATGCTGAACGAGCTGAGAATTACTATGATCAAGCT GTTAAAACTTCCCCTGACGACTGTTTTGTCCTGGCTTCATATGCTGAATTCCTTTGGGAT GCTGAAGAAGAAGAAAAAGAAGAAGAAGAAAATCAAGGGGTTAAACATGAAACCGAGCCC AGCCACACATCTTCGTCCAATTTCTTCCATGGAGCTCCTCACCATTCTCCTTTAACTGCA GCCTCTTAG
PEP MLLRSSSAPLLNSWLSHSKDFSPEPESLLTRTRSVSLSSFSSFHSPSIDSTKKTTTQILL EADIPSQPKPKKKNPIPLSLGKKSKTKAKNVEEQEEELKPSSISSSATQRLFSSSGLGVK LMEDEDSAVGKEDDGLQTLVLGGGAGSNGGKICGGGGSGKGPDGGDGGGSGFFESNNHGS GSTDAYYQKMIQADPGNCLLLGNYAKFLKEVRGDYAKAEEYCGRAILANPNDANVLSLYA DIIWKTQKDAERAENYYDQAVKTSPDDCFVLASYAEFLWDAEEEEKEEEENQGVKHETEP SHTSSSNFFHGAPHHSPLTAAS


| Top |