Cherry SNP DataBase

Gene information

Gene Pav_sc0000184.1_g280.1.br
Chromosome name PAV_r1.0chr1
start 9606263
end 9606568
PAV_r1.0 name Pav_sc0000184.1
start 180441
end 180746
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103337702
Sequence CDS ATGCATGTCGTGGCTACAATTCTAGCAAAGAAAGATTCAGTTTATGATTACGTTGAGTGT TACTACAAATCTGACTTCTTTCGAAAAGTCTATGAGAGTCATATTCTTCCTATTCCAGAT ATTGGGAAAGGTTTGGGCAGCAACGATTTAGCTGCTGCAGTTGTGCTTCCGCCAATTACC AAGAGGCCAACCAAAAGACCACCAACGAAGTGGATCAAAGCTTTTGGTGAAGGTACAAAG CCATTGAAACGCATTCGGTGCAATGTTGCTAGGCACAACATGAAGACTTACAAGGCGGTG ATATGA
PEP MHVVATILAKKDSVYDYVECYYKSDFFRKVYESHILPIPDIGKGLGSNDLAAAVVLPPIT KRPTKRPPTKWIKAFGEGTKPLKRIRCNVARHNMKTYKAVI


| Top |