Cherry SNP DataBase

Gene information

Gene Pav_sc0000195.1_g480.1.mk
Chromosome name PAV_r1.0chr1
start 35826950
end 35833282
PAV_r1.0 name Pav_sc0000195.1
start 325938
end 332270
direction -
Annotation NR PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform X1
Sequence CDS ATGGCTGTTGAGGAGGAGAAGCAGACGGCGAAGCCTGTTTTCGATGAAGAAGCAGCGTCG GCGCTTGCGAAGGAGCTGAGAGCCACCTTCGCCTCTGCCAAGACTCGGAGCTATCAATGG AGAGTGTCGCAGCTCAAGAGCCTCCTTAAGCTCACCACCAGCAACGAGCCGGCGATCGTC GACGCTCTTCGCTCTGACCTCTCCAAGCCCGAGCTCGAGTCCCAAGTCTACGAGATATCT ATGTTAAAGAACTCATGTAAGTTGGCACTCAAAGAGCTGAGAAATTGGATGAAGCCAGAA AAGGCTAAAACTTCAATAACCACTTTCCCTTCGTCAGCCGAAATAGTGTCTGAACCTCTT GTACTGTCCCTTGATCCAGTTGTCGGTGCCATAGCGGCTGGTAATGCTGTGGTCCTTAAA CCATCAGAACTTGCTCCAGCTACATCGTCATTGCTTGCAAAACTAGTAGGTGAATATATG GATAGCTCTTCTATAAGAGTTGTTGAGGGGGCTGTTGCTGAAACATCTGCACTGTTAGAG CAAAAGTGGGACAAAATATGTTACACAGGCAATGGAAGAGTGGGACGTATAGTGATGACT AGTGCTGCAAAGCACCTTACACCTGTTCTTCTAGAGCTCGGTGGAAAATCTCCTGTTGTT GTTGATTCTGGTATCAACTTACAAGTTGCAGCTAGGCGAATAATTGTAGGAAAGTGGGGG TGTAATAATGGACAGGCATGCATTGCCCCCGATTACATTGTAACAACAAAAGATTTTGCT CCTAAGCTGGTGGATTCTTTGAAACGTGAATTGGAGAATTTTTATGGAAATAATCCATTA GAATCAAAAGATTTGTCTCGTATTGTGAATTCAAATCACTTTGCTCGCTTGATAAAGCTC TTGGATGAGGATAAGGTTTCTGGTAAGATCGTCCTGGGAGGTGAAAGGGACAAAACCAAC TTGAGGATAGCTCCCACCATCTTGCTCGATGTCTCACGGGACTCATTGATCATGAATGAG GAAATATTTGGTCCTTTGCTTCCCATTCTCACGGTCGACAGAGTGGAAGAAAGTTTTGAC TTGATAAACTCAGGAACAAAACCCCTTGCTGCATATTTGTTTACAAACAATAAGAAGCTG AAGGAGCACTTTGTAAGGACTGTCTCCGCCGGGGGTTTGGTTGTCAATGACACTACCATA CACCTTGCTGTTCCGTCCTTGCCATTTGGAGGAGTTGGGGAAAGTGGAATGGGTGCATAC CATGGAAAATTCTCCTTTGATGCATTTAGCCATAAGAAGGCAGTTGTTTATCGAGGTTTC GCTGGTGATGCTTCTGTGAGGTACCCACCATACACAAAGGGGAAGCTAAGACTTCTTAAG GCTCTGATCGGCGGTGGCATATTAAGCATAATCCGCGCTCTGTTTGGATGGTCCAAGGCT TAA
PEP MAVEEEKQTAKPVFDEEAASALAKELRATFASAKTRSYQWRVSQLKSLLKLTTSNEPAIV DALRSDLSKPELESQVYEISMLKNSCKLALKELRNWMKPEKAKTSITTFPSSAEIVSEPL VLSLDPVVGAIAAGNAVVLKPSELAPATSSLLAKLVGEYMDSSSIRVVEGAVAETSALLE QKWDKICYTGNGRVGRIVMTSAAKHLTPVLLELGGKSPVVVDSGINLQVAARRIIVGKWG CNNGQACIAPDYIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHFARLIKL LDEDKVSGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFD LINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAY HGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGWSKA


| Top |