Cherry SNP DataBase

Gene information

Gene Pav_sc0000200.1_g050.1.mk
Chromosome name PAV_r1.0chr2
start 12609720
end 12611994
PAV_r1.0 name Pav_sc0000200.1
start 40562
end 42836
direction +
Annotation NR PREDICTED: nucleoside diphosphate kinase 1
Sequence CDS ATGGAGCAAACTTTCATCATGATCAAGCCTGATGGGGTTCAAAGAGGCCTGGTTGGTGAC GTCATTAGCAGGTTTGAGAAGAAGGGCTTCTATTTGAAAGGTTTGAAGTTCATCAATGTG GATCGTCCTTTTGCTGAGAAACACTATGAGGACTTGTCTGCAAAGCCCTTTTTCAGTGGA TTGGTTGATTATATTATTTCTGGTCCCGTTGTTGCTATGATTTGGGAGGGTAAGAATGTT GTCCTAACTGGCCGAAAGATTATTGGGGCCACCAACCCAGCAGAATCCGCCCCTGGAACC ATCCGTGGTGATTATGCAATTGAGATTGGCAGGAACATCATTCATGGAAGCGACTCAGCA GAGAGTGCAAGGAAAGAGATTGCACTGTGGTTCCCTGATGGCCCTGCTAACTGGCAGAGC AGCGTTCACCACTGGATCTATGAGTAA
PEP MEQTFIMIKPDGVQRGLVGDVISRFEKKGFYLKGLKFINVDRPFAEKHYEDLSAKPFFSG LVDYIISGPVVAMIWEGKNVVLTGRKIIGATNPAESAPGTIRGDYAIEIGRNIIHGSDSA ESARKEIALWFPDGPANWQSSVHHWIYE


| Top |