Cherry SNP DataBase

Gene information

Gene Pav_sc0000201.1_g040.1.br
Chromosome name PAV_r1.0chr8
start 3566374
end 3568860
PAV_r1.0 name Pav_sc0000201.1
start 16455
end 18941
direction +
Annotation NR PREDICTED: F-box/LRR-repeat protein At3g58900-like
Sequence CDS ATGCAGATGCACTACGAAGGTCTGCTGAAAAGTTTTGCGAGAGCCCCGAAATTCTCCCAC AATTCCCTCAAGGTTGTGGAAATGGTAGGGTATGTTGGTAGCACAAGTGATTTTGCGCTG GTTCGTTACTTGATAAAGACTGCTGTAAATCTGGAGAAAATTGTTGTTAATCCTGTCCAG ACCTGGCTTCTACAGAGCCTCAACTACAGAATAATGAAAGACCAAATACTGAAGTGGCAA GAAACTAATTTGACTCTGGTGGCAACAAATTCACTGGAACTATTCCTGCGTCATTGTCAA ATTCTTCTAGACTTCGGATGCTTAATTAATCTAGCTGAAAATGGTCTCACCGGGACACTC CCTGCTGAAAATCTTGGAAGCTTGCGAAGCTTAGTTTCCATGAACTCCAGCCGCAATAGA CTGGGAAGTGGAACAACTGGCGACTTGAACCTTCTCAGCTTTTTGGCTAATTGTACTAGC CTAGAGGACTTTGGTATGGACACTAACCATTTCGGAGGAGAAATGCCAAGTTCATAG
PEP MQMHYEGLLKSFARAPKFSHNSLKVVEMVGYVGSTSDFALVRYLIKTAVNLEKIVVNPVQ TWLLQSLNYRIMKDQILKWQETNLTLVATNSLELFLRHCQILLDFGCLINLAENGLTGTL PAENLGSLRSLVSMNSSRNRLGSGTTGDLNLLSFLANCTSLEDFGMDTNHFGGEMPSS


| Top |