Cherry SNP DataBase

Gene information

Gene Pav_sc0000203.1_g170.1.mk
Chromosome name PAV_r1.0chr6
start 16697758
end 16700338
PAV_r1.0 name Pav_sc0000203.1
start 72381
end 74961
direction -
Annotation NR PREDICTED: MLO-like protein 3
Sequence CDS ATGGCAGTAGCCACTGAAGCCACCTCTATAGAGTACACGCCGACATGGGCACTTGCCACC ATTTACTTCTTCTTCATTTTCACCGCCGTCTTCCTCCGGCACTCCATCCATCTCCTTGCC AACGTAAAGTTGATGCTTCTGGGATTTGCATCACTTTTATTGGCGGTAACCCAAGATTCT ATTTCCAAATTCTGCATACCAGCCAAGCTAATAGACACCATGCTTCCATGTCGCAAAAGG GTTGCACCCGAATCAACCCAAAAAGATGAAGATGATGAGCACTTTGTGGCAAGAAACTTC TCGACAGGAGCAGGTGGTTTGTATGGTGAAATTCATAGGTTAATTGCGGAGGAAGCTGTT TCTGATTCTTGCAGTGACGGAAAAGTACCTTTCATGAAAAAACATTCTCTGCGTCAGCTT CACATACTGATTTTCGTGCTGGCGGTTATGCACATTGTGTATAGTGTTCTCACCATGGCT TTGGGATGGGCCAAGATGAGGCGCTTTCAAGCTTGGGAGAAAGATGCTCAAGCTCAAACA ATGGGCCGGCACCAAGTCGCCAACGCTTCTAATAATTTAGTTTTGGATGATTGTCAAATG GAGCAGAAATGTTTTTTCAGGCAGTTCTACAACTCAATAGAAAAAGTTCACTATCTCACC TTGAGACATGGCTTCATATCGACTCACCTGTCAAGCAGGCACAACAACTTCAATTTCCAA CAGTACATACAGCTATCCTTGGAGGAAGATTTCAGGATTATGGTTGGCATCAGCCCTTTA ATGTGGTTTCTAGCAGCTGCTTTTATGCTGTTGGATGTATATGGCTGGTATGTGTATCTC TGGATATCCTATGTTCCAATCTTGGTCGTTCTGGTTTTAGGAACCAAACTTGGACACATT GTTGCAACAATGGCTCTTCAAATTAAAGAACAGAACAGTGCAGTTTCCGAAACACGTCTT GTTCAACACGATGTCGATGACCTCTTCTGGTTTAGGAAACCAGAATTTGTCTTGGTGCTG CTACATTATACTCTCTTCGTGATCCAGTTCGGGTTGACATCTTGCTACCACGAGCACACC GCGATCATTGTTACTAGGGTTTTCTTAGCGTAA
PEP MAVATEATSIEYTPTWALATIYFFFIFTAVFLRHSIHLLANVKLMLLGFASLLLAVTQDS ISKFCIPAKLIDTMLPCRKRVAPESTQKDEDDEHFVARNFSTGAGGLYGEIHRLIAEEAV SDSCSDGKVPFMKKHSLRQLHILIFVLAVMHIVYSVLTMALGWAKMRRFQAWEKDAQAQT MGRHQVANASNNLVLDDCQMEQKCFFRQFYNSIEKVHYLTLRHGFISTHLSSRHNNFNFQ QYIQLSLEEDFRIMVGISPLMWFLAAAFMLLDVYGWYVYLWISYVPILVVLVLGTKLGHI VATMALQIKEQNSAVSETRLVQHDVDDLFWFRKPEFVLVLLHYTLFVIQFGLTSCYHEHT AIIVTRVFLA


| Top |