Cherry SNP DataBase

Gene information

Gene Pav_sc0000205.1_g190.1.br
Chromosome name PAV_r1.0chr1
start 41392752
end 41403089
PAV_r1.0 name Pav_sc0000205.1
start 117733
end 128070
direction +
Annotation NR PREDICTED: TMV resistance protein N-like
Sequence CDS ATGGATGCCAGGAAAGCCCATAAAGCCTCTTCATCCTCACCATCCTCCTCATCAAAACGT TGGGATTACCACATATTCTTGAGCTTCAGAGGTGAAGACACGCGCAAGGGCTTCACGTCC CACCTTCACAAGGCATTAGAAAGCAGGGGATACGATGTTTTTATGGACGAGGACGATCTA CAAGTAGGGCAAGTTATAAAACCAGAACTGTTGCAGGCAATCGAAAAGTCCAAGATCTCT GTAATTGTCTTCTCAACGAGGTATGCAGATTCCAGTTGGTGTCTTGATGAGCTGGTGAAG ATCATGGAGTGTAGAAGAACACTGAATCAAATCGTTTTGCCAATATTCTACAATGTGGAT CCTTCAGACGTCAGAAAACAGACTGGTACTTTGGCATCTGATTTTCAGAAACATACCATC CGACATAAAGATGAGGTGGTAAAGGAGTGGAGAAAGGCTCTTACTGAAGCTGCGAATTTG TGTGCCGGGGTTCTCGAAGACAGGAATGAAGCAAAGTTTATCGAGGCATTTATTGAGAAT AAAATTATCGGACGGCTTTCCACAACTCCCCTACCAGTAGCCGCCTACCCGGTTGGAGTC GACTCTCGTGTACATGATATGATCAGTTATCTTTTAGGTGGTGGATCACAAGACGTTGTC ATGATTGGAATTTGGGGGATGGGCGGACTGGGCAAAACAACAGCTGCGAAGGCCATTTAT AATCGAATTAAGGATAAATTCGAAGCTCATGGTTTCCTTGGAGACATTAGGGACACTGCA AATAGACATGGTCTTGTTTATTTGCAAAAACTACTTCTTGCTGAAATCTACAAGAAACCG ACCAAATTTCACATAAGTTGTGTTGATGGAGGGATGGGTATGATAAAAAAAGAACTTGGA TGTAAAAGGGTACTTGTAATTATCGACGATGTAGATGAAAAGGAGCAACTCGAAGCGATA GTTGGAAATCGTGATTGGTTTGGCTCTGGAAGTAGAATTATAATAACTACTAGAGATAAA CATTTTCTAGACGTACTTCGTGTGGATAAAACTTTCACGGTTCCAGAAATGAATCCCGAT GAAGGTCTTGAGCTCTTTTGTCGGCATGCCTTTCAAAAAGGTTATCCTAATGAACAATAT CTTGAACTCTCAGAAAAGGTAGTTTTTTATAGTGGAGGTTTGCCACTGGCACTTAAAGTT TTAGGCTCTTTCTTGATTGGAAGAACCATAGCAGAGTGGGAAAGCCAATTGCAGGAATTG GAAGGAATCCCTCCGAAAGATATTCTAAAAAAACTTAGAATAAGCTATGACGGTCTAGAT CGGGACGAGAAGTGTATATTCCTTGATATATCTTGTTTCTTCATTGGAATGAACAAAGAC CATGTCAGAAAAATATTAGATGGATGTGGCTTTAAAGCAGAAATAAAAATCAGCGTGCTC CTTCAGCGGTGCCTTGTTACTGTTAATGAACAGAACCGGCTAATGATGCATAATTTACTT CGAGACATGGGCAGAGCAATCAGTCAAGAAGGTGACAAAGAAGACCGGCGTAGATTGTGG CTCCGTGAAAATGTGACAGATGTATTGGAAGACAAATCTGGAACTAAAAAAGTTGAAGGA CTTGGTCTAAATCTGCGAAGCTCGGAAAAGGCTAGTTTCGGTACTGAAGGATTTAGCAAA ATGAGAAAACTGAAATTGCTCCAGCTCAACTATGTAGAGCTCACCGGAGAGTACAAATTT CTTTCCAAAAATTTAAGATGGTTGTGCTGGCATGGATTCCTTCTAGATTCGATACCAGGT GACTTTGATCTAACAAGCCTAATTGCTATGGACCTGCAGTTCAGCAAACTCAAAGTAGTT TGGAAGGATTGCAAGTTGCTTGAGAAGTTGACAATCATTAATCTGAGTCATTCTCATGAT CTAACAACATCACTAGACTTTTCAAAAGTCCCAAATCTCGAGGAGTTGATATTGGAATGG GACATGGTATCATTGAGAACTCTGGAAGCAGACGATACAGCTGTAACAAAAGTACCATCT TCCATAGTAAAATTGAAGAACCTGAGATCTTTATCTCTATGTGGTTCGGAACGGTTAACT GGCTCTTTGCCCCATTCTTACCTGAGATCAACCGGTTTTTTGCCCCCTTTGTTAGATGGC TTAAACTCTTTAAGAAAATTAGCTCTTGCAGACTGCAGTTTAACAGATGATGAACTCCCT AAGGATCTTGGGAGCCTAAGTTCCTTAGAACATTTAGATTGTGGACAAAATTCTTTTTGT AGACTGCCAAGCCTAAGTGGTCTTTCAAAGCTGGAATATTTGTGTTTAAATGACTGCAGA AAACTTCGTGCAATCCCAGAATTACCGAAAAATCTGAAAGTTCTGAGAGGGTTTGGCTGC ACAGCATTGGAAACAATGCCAGATTTTTCAGAAATGTCAAGTATAAGAGAACTATATTTA TCTGATTCGTACAAACTCACTGAGATTCCTGGCTTGGATAAGTCATTAAACTCCGTGACA AGGATTCATATGGAAGGCTGCACCAATCTCACCACCAATTTCACAAAGAAAATCCTACAG GGATGGACTTCTTGCGGATTTGGAGGCATTTATCTTGAAGGAATTTATGGTATTCCAAAG TGGTTCAAGTTGGTCGGTAATGAGTACAATGTAGTGGATTTTAAAGTGCCCCAAATTTTC AGTTGTGATTTAAAAGGGTTAACATTGTGTTGCGTTTACTCTTCAGACAACCCAAAACCA AAAGATGGTCTTGGCATTATGGTTAGAAATGTAACGCAGGGAACTACTTTGCACACCTGG CCAGCAATTGCCTCGGTAAAAACAGACAGTAAACATGAAGATTATTATCTTTGGCAGGGA CAACTATCGAACGATAGGCTCAGTTTGCAAGGTGGGGATAAAGTCCGGCTTTCTGTATTT GCTACAGTTGATTTTGTGATAGTGAAGAAAGTAGGGGTCAATCTAGAATGGGACAAAGTT ATGAAGGAAAATATGCATGATTCGGATCCTCATCTATATGATTTGGACCCAAATCCTGAT TGGTTGTCGAGAACTCCAGATGAGGCAGGACCAAGCCAAGGCGAACCATTAAGAGAATTA GTTCTTGCAAGCTGCAATTTAACTGATATTGAATTATCTAAAAAATTTGAAACAGCAGGT TCTACAGATGTTCGCATGATTGGTATTTTGGGGATGGGCGGCATTGGAAAAACAACGCTT GCCAAAACCATTTATAACAATTTTGAACGTATCTTTGAAGGTAGGAGTTTCCTTGCAAAC GTGAGGGAAGTAATTGCACACCAACCCATTACTGGTCTGGTTGGTTTGCTAGAACAACTT CTAAATGATATCTTGAAAAGCAAGGACCCCATAAAGGTTGATTCTGTTGAGGTGGGGATC GATATGATAAGAGCAAGACTTTTCTGTAAAAGAGCACTTGTCATAATTGACGATGCGGAT GATCTACAGCAACTAAAAGCAATAGCTGGAGCTCGTGATTGGTTTGGTCCTGGAAGTAGA ATTGTTATAACAACAAGAAATAAACATTTGCTAGAGCAAGTTGGAGTGGATAGCATATAT ATGGCTGAAGAAATGGATGAAAAAGAAGCTCTAGAGCTTTGGCATGCCTTCGAAAGTGAT TATCCTAATCAAGAATATCTTGACCTCGAAAGTGATTATCCTAATCAAGAATATCTTGAC CTCTCAAAACGTGTAATTCGTTACTGTCAAGGTTTGCCACTAGCACTTAAAGTTTTAGGG TCTTTTCTGAAGAAAAGAACAACAGCAGAGGGGGAAAGCCATTTGGAGAAATTGGAAAGA AGTCCTCCTGATGGAGATATTCAAAAAATACTCAGAATAAGCTTTGACAGCCTACCTGAT TATACAACGAGAGAGATATTCCTTGATATATCTTGTTTCTTTATAGGAATGGACAAGGAC TATGTCACACAAATATTAGATGGATGTGGCTTCTCTGCAACGATAGGAATCAGTGTCCTC ATTGAACGGTGCCTTGTAACTGTTAGTGAGCAAAATGAGCTGATGATGCATGATTTGCTT CGAGACATGGGAAGAGAGATCGTTTATGAAAATGCACACGGACACCCTAAAAAATTTAGT AGATTGTGGAAACGTGAAGACGTAACAGATGTATTGAGTGATGAATCTGAAACTGAAGAA ATTGAAGGAGTTGCTCTAGATTTGCATCGAGATGTGTTTGTGGTTGTGTTTCGATATTTG GATCCAGATTTCCCTATATTCAGTACACAAGCATTTACCAACATGAAAAAACTGAGGTTA CTCCGCCTCAGCGACGTAGTGCTCACTGGAAAGTACAAAGATTTTCCCAAAAAGTTAATA TGGTTGTGGTGGCATTATTTTCCTAGAGAGTCCATACCAGATGACTTTCCTGTGCAACCA AAACTAGTTGCTTTAGACCTGCAATATAGCCAACTCAAAATAGTTTGGAAGGATTGCAAG TTGCATGAGAATTTGAAAATCCTTAATCTCAGTTATTCCCTTAAGCTAACAAAATCACCA GACTTTTCAAAACTCCCAAATCTCGAGGAATTGATATTGAAAGGTTGTAAGGAGTTGATT AAGGTTCACTCATCCATCGGGGATCTTGGAAGACTTTCTTTGGTAAATCTTGAAGGCTGC ATAAGTCTATGGAATCTCCCACGGAATTTCTATAAATCCAAGTCTATTGAAACTCTTATA CTGAATGCTTGTCAAAGGTTTGGAAAGTTGGCTAAGGGCTTAGGGAACATGGTATCATTG ACAATTTTGGAAGCAGATAAGACAGCCATCAGACAAATTCCATCTTCCATAGTAAAATTG AAGAAGTTGAGAAGTTTATCTCTATCTGGCCATCGGTGGTTAACTGCATGCAGAAGACTT CGTGCAATCCCAGATTTACCAACCAATTTGTATGTTCTGAAAGCAAATGACTGCCCAGAA TTGGAAACACTTCCAGATTTTTCAAAAATGTCGAATATGAGAGAATTGTATCTCCGTGAT TCGTTCAAACTCACTGAGGTTCCAGGCTTGGATAAGTCATTAAACTCCATGACAAGGATT CATATGGAAAGCTGCACCAATCTGACTGCCGATTTTAGGAACAACATCCTACAGGGATGG ACTTCTTCCGGATATGGTGGAATTTATTTGAATGGAATTTATGATATTCCTGAGTGGTTC AAAATCGTCAATGATGTGGACAATATCGTCTTCTTTGAAGTTCCTCAAAGAATCATGGGT CGTGATTTAAAAGGGTTGACTATATGCTTCGGTTACTCAAGCAGGTCTTATTCGCATTAT CCGGAATATGTAGATTCTCAAGAAGGTCTTATTGGCATTATCGTTAGAAATCTTACCAAA CAAACTGCTTTGCGCACCCGGATAGCATTTGCCTCGGTAAGACCCAACAGATACGGTGAA CCTGAAGACGATTATCTTTGGCAGGGACAATTGTCAAACGATATGCTCCGTTTGGAAGGC GGTGACCACGTATCGATTCTTGTAAGGCCTGATGATGTTGATTTTGTGAGAGTGAAGAAG ACAGGGGTTCATCTAGAATGGGACAAACTCATGAAGGAAAATATGGATAATCCGGATCCA TATCTGGAGTTTTTTAGGGGAGTTGATGACGCATTTTTCAGGGGCAGTGTTATACATGAA CAATTAGCAGTGGAATCATATCTGAATTTTTTTGCGATTGTTCCCGATGATGAAATGAGT GATATAGTTGAAGAATCAGCAGTGGAAGACGATCCTTTTGGCCGTGGCGGATGA
PEP MDARKAHKASSSSPSSSSKRWDYHIFLSFRGEDTRKGFTSHLHKALESRGYDVFMDEDDL QVGQVIKPELLQAIEKSKISVIVFSTRYADSSWCLDELVKIMECRRTLNQIVLPIFYNVD PSDVRKQTGTLASDFQKHTIRHKDEVVKEWRKALTEAANLCAGVLEDRNEAKFIEAFIEN KIIGRLSTTPLPVAAYPVGVDSRVHDMISYLLGGGSQDVVMIGIWGMGGLGKTTAAKAIY NRIKDKFEAHGFLGDIRDTANRHGLVYLQKLLLAEIYKKPTKFHISCVDGGMGMIKKELG CKRVLVIIDDVDEKEQLEAIVGNRDWFGSGSRIIITTRDKHFLDVLRVDKTFTVPEMNPD EGLELFCRHAFQKGYPNEQYLELSEKVVFYSGGLPLALKVLGSFLIGRTIAEWESQLQEL EGIPPKDILKKLRISYDGLDRDEKCIFLDISCFFIGMNKDHVRKILDGCGFKAEIKISVL LQRCLVTVNEQNRLMMHNLLRDMGRAISQEGDKEDRRRLWLRENVTDVLEDKSGTKKVEG LGLNLRSSEKASFGTEGFSKMRKLKLLQLNYVELTGEYKFLSKNLRWLCWHGFLLDSIPG DFDLTSLIAMDLQFSKLKVVWKDCKLLEKLTIINLSHSHDLTTSLDFSKVPNLEELILEW DMVSLRTLEADDTAVTKVPSSIVKLKNLRSLSLCGSERLTGSLPHSYLRSTGFLPPLLDG LNSLRKLALADCSLTDDELPKDLGSLSSLEHLDCGQNSFCRLPSLSGLSKLEYLCLNDCR KLRAIPELPKNLKVLRGFGCTALETMPDFSEMSSIRELYLSDSYKLTEIPGLDKSLNSVT RIHMEGCTNLTTNFTKKILQGWTSCGFGGIYLEGIYGIPKWFKLVGNEYNVVDFKVPQIF SCDLKGLTLCCVYSSDNPKPKDGLGIMVRNVTQGTTLHTWPAIASVKTDSKHEDYYLWQG QLSNDRLSLQGGDKVRLSVFATVDFVIVKKVGVNLEWDKVMKENMHDSDPHLYDLDPNPD WLSRTPDEAGPSQGEPLRELVLASCNLTDIELSKKFETAGSTDVRMIGILGMGGIGKTTL AKTIYNNFERIFEGRSFLANVREVIAHQPITGLVGLLEQLLNDILKSKDPIKVDSVEVGI DMIRARLFCKRALVIIDDADDLQQLKAIAGARDWFGPGSRIVITTRNKHLLEQVGVDSIY MAEEMDEKEALELWHAFESDYPNQEYLDLESDYPNQEYLDLSKRVIRYCQGLPLALKVLG SFLKKRTTAEGESHLEKLERSPPDGDIQKILRISFDSLPDYTTREIFLDISCFFIGMDKD YVTQILDGCGFSATIGISVLIERCLVTVSEQNELMMHDLLRDMGREIVYENAHGHPKKFS RLWKREDVTDVLSDESETEEIEGVALDLHRDVFVVVFRYLDPDFPIFSTQAFTNMKKLRL LRLSDVVLTGKYKDFPKKLIWLWWHYFPRESIPDDFPVQPKLVALDLQYSQLKIVWKDCK LHENLKILNLSYSLKLTKSPDFSKLPNLEELILKGCKELIKVHSSIGDLGRLSLVNLEGC ISLWNLPRNFYKSKSIETLILNACQRFGKLAKGLGNMVSLTILEADKTAIRQIPSSIVKL KKLRSLSLSGHRWLTACRRLRAIPDLPTNLYVLKANDCPELETLPDFSKMSNMRELYLRD SFKLTEVPGLDKSLNSMTRIHMESCTNLTADFRNNILQGWTSSGYGGIYLNGIYDIPEWF KIVNDVDNIVFFEVPQRIMGRDLKGLTICFGYSSRSYSHYPEYVDSQEGLIGIIVRNLTK QTALRTRIAFASVRPNRYGEPEDDYLWQGQLSNDMLRLEGGDHVSILVRPDDVDFVRVKK TGVHLEWDKLMKENMDNPDPYLEFFRGVDDAFFRGSVIHEQLAVESYLNFFAIVPDDEMS DIVEESAVEDDPFGRGG


| Top |