Cherry SNP DataBase

Gene information

Gene Pav_sc0000212.1_g1080.1.mk
Chromosome name PAV_r1.0chr7
start 16869278
end 16873695
PAV_r1.0 name Pav_sc0000212.1
start 573874
end 578291
direction -
Annotation NR PREDICTED: mitogen-activated protein kinase kinase 6 isoform X1
Sequence CDS ATGAAGACGAAGACACCATTGAATTTGACGCAACTCAAGCTCTCTGTTCCAGCTCAAGAA GCCAACATCAAGTCTTTCTTGACAAAGATGAAGACGAAGACACCATTGAATTTGACGCAA CTCAAGCTCTCTGTTCCAGCTCAAGAAGCCAACATCAAGTCTTTCTTATTCTTGATAGCG TATGTATTTGTGCTCTGTTTGGGTTCGGAGTGCCTGAGAGAATGGAGGGAATTGCAAATG GTTTTGCACAAGACTGCCAGTGGTACATTTCATGACGGCGATCTGCGTCTAAACCAGAAA GGGTTGCGGCTTATCTCTGAAGAAAAGGAGGCCCAAGATCAGCCTTCTGACAGTAAGGAG CTCAATTTCGAAATTTCATTGGAAGACCTTGAGACAATTAAAGTCATTGGGAAGGGAAGT GGTGGTGTAGTACAACTTGTTCGTCATAAATGGGTCGGCAAATTATTTGCCTTGAAGGTG ATCCAGATGAACATACAAGAGGAAATTCGTAAGCAGATTGAGCTCAATTTCGAAATTTCA TTGGAAGACCTTGAGACAATTAAAGTCATTGGGAAGGGAAGTGGTGGTGTAGTACAACTC GTTCGTCATAAATGGGTCGGCAAATTATTTGCCTTGAAGGTGATCCAGATGAACATACAA GAGGAAATTCGTAAGCAGATTGTATTACAAGGTCTTGTCTACTTGCATAATGAAAGGCAT GTAATACATAGAGACATAAAACCATCCAATCTGCTAGTAAACCATGAAGGGGAGGTCAAG ATTACTGATTTTGGTGTGAGTGCTTCGCTTGCTAGCTCTATGGGTCAAAGGGACACATTT GTTGGTACTTACAATTACATGTCGCCGGAGAGGATCAGTGGCAGTACTTATGACTATAGC AGTGATATTTGGAGTTTAGGCTTGGTGGTACTTGAGTGTGCTATTGGGAGGTTTCCTTAC ATGCAATCTGAAGATCAGCAAAGCTGGCCAAGCTTTTATGAACTTTTGGAGGCAATTGTG GAAAGTCCACCACCTTCTGCTCCGTCGGATCAGTTCTCCCCTGAGTTTTGTTCTTTCGTG TCTGCCTGCATACAGAAGAACCCTCAAGACAGATCGTCATCTTTAGACCTTTTGGGTCAC CCCTTCATCAAAAAGTTCGAAGACAAAGACATTGATCTTGGGATCCTGGTTGGTAGCTTA GAACCTCCTGTAAATTTTCCTAGATAG
PEP MKTKTPLNLTQLKLSVPAQEANIKSFLTKMKTKTPLNLTQLKLSVPAQEANIKSFLFLIA YVFVLCLGSECLREWRELQMVLHKTASGTFHDGDLRLNQKGLRLISEEKEAQDQPSDSKE LNFEISLEDLETIKVIGKGSGGVVQLVRHKWVGKLFALKVIQMNIQEEIRKQIELNFEIS LEDLETIKVIGKGSGGVVQLVRHKWVGKLFALKVIQMNIQEEIRKQIVLQGLVYLHNERH VIHRDIKPSNLLVNHEGEVKITDFGVSASLASSMGQRDTFVGTYNYMSPERISGSTYDYS SDIWSLGLVVLECAIGRFPYMQSEDQQSWPSFYELLEAIVESPPPSAPSDQFSPEFCSFV SACIQKNPQDRSSSLDLLGHPFIKKFEDKDIDLGILVGSLEPPVNFPR


| Top |