Cherry SNP DataBase

Gene information

Gene Pav_sc0000212.1_g1190.1.mk
Chromosome name PAV_r1.0chr7
start 16814873
end 16821147
PAV_r1.0 name Pav_sc0000212.1
start 626422
end 632696
direction +
Annotation NR PREDICTED: 6-phosphofructokinase 6-like
Sequence CDS ATGGGCCAGTGGTTGCAGCTTCCTGGACTAAAGACTGCACTTTCCAATTGTTGTCAAATT AAACCAATTTTCACCAAGACCTCCACTGCTAAGCTCAGTTTTCCTTGCATGCCATTTATT GGGGGTGCCTTCAAGAAAACAGAAACTCATGTTGTATCTCCTAACATATCTTCACCAAGT GTGACGACGGGGTTACTTGATGCATGGGACGATGAATATGGTGGAGTCATAATGAATTCA GAGAGCCTACCCATGAGTGCAAATGCTTTTGCATCTGCTTTTCAGGCTTCTCTGTCCAAC TGGAAAATGAAGGGGAAAAGAGGGGTATGGCTCAAAATACTACAAGAGCAAGCTGATCTT GTCCCAATTGCAATTCAGGAGGGTTTCAACTATCACCATGCTGAACCAGGATATGTTATG TTAACATACTGGATACCCAATGAGCCTTGCATGCTTCCTGCTAGCCCCTCACATCAAATT GGCATTGCAGGATTTGTGATCAATGACAAAAGAGAGGTTCTTGTGGTCAAAGAGAAGTGC CCTTGTAGCTGCTGTGGTGTGTGGAAGTTGCCCACTGGTTATATCAACAAGTCTGAAGAC ATATTCTCTGGAGCTATCAGAGAAGTGAAAGAAGAAACTGGTGTTGACACAACTTTCCTG AAAATGGTAGCTTTCAGGCATGCACACCTGGTTGCATTTGAGCAGTCAGACTTGCTCTTT GTCTGCATGCTCAAGCCATTGTCTTATGACATCACAATAGATGACAAGGAAATCCAAGCT GCTAAGTGGATGCCTCTTGATGAGTTTATTGCCCATCCATATTACCAAGATGACCCCTTG TCCAAGAAAGTCATTGAGATATGCATTGCGGCTAAAGAAGATCGCTACAGTGGCTTCACT GTTCACGCTTCTTCCTCTGCAACCATTTCTCTGAAGCCTCCACGTAACTCGGATTCAAAC TCGTTTTCGGGTTCCAGAAATTGGGATACGAGCTCTTCTGGTTCGGGTTTCAAAGTCGGG TCCTTTTCTCGTTCCCTGATGGAAAACAAGCCTCATAAGGTTGTGGTCGGTGACGCTGGT TATGTGCTCGAAGATGTTCCTCATTTCTCTGATTACATTCCTCATCTCCCTACCTACCCA AATCCATTGCAAGACAATCCTGCATACTCAGTCGTCAAGCAGTACTTTGTTAATGTGGAC GATACTGTTGCCCAAAAGATTGTTGTTCACAACAATAGTCCGAGGGGCACACATTTTCGG CGCGCTGGACCACGTCAAAAGGGAGGATACAGGGGTTTCTATTCTCGTAACACAATTTCT TTGACTCCTAAGAGTGTGAACGATATCCATAAGCGTGGTGGAACCATCCTTGGAACATCA CGAGGCGGCCACAATACCTCAAAGATCGTTGACAGCATTCAAGACCGTGGAATCAATCAG GTTTACATAATTGGAGGAGATGGAACCCAGAAGGGGGCATCTGTGATATATGAGGAAATT AAAAGACGTGGTCTCAAAGTGGTAGTTGCTGGAATCCCCAAAACCATTGATAATGACATT CCGGTTATTGACAGCCGAGATGTGGATTGTTGCTTAATTCCAGAATCACCTTTTTATCTG GAAGGTCCTGGTGGACTTTTCGAATACATAGAGAAACGACTCAAAGAAAATGGGCACATG GTTATTGTCATCGCTGAAGGTGCTGGGCAGGAGCTACTTTCTGAGAGCATGCATTCTATG GCCAAGCAGGATGCTTCAGGAAACAAGCTTCTCCAAGATGTTGGCCTATGGATTTCCCAA AAGATCAAGGATCATTTTTCAAAAAGGAACAAAATGACCATAAACCTCAAATATATAGAT CCTACGTATATGATTCGAGCTGTTCCGAGCAACGCCTCTGATAATGTGTACTGCACCCTC CTTGCTCAAAGTGCTGTCCATGGAGCAATGGCAGGTTACACAGGATTTACAGTCGGGCCT GTCAATGGGAGACATTCTTATATACCTTTCCATAGAATCATTGAGCAGCAGAACAAGGTT GTGATAACTGACAGAATGTGGGCTCGGCTCCTATCTTCCACAAACCAGCCAAGTTTTTTG AGTGCTAAAGACGTCGTTGAGGACAAGAAAGAAGAACTGCCAAGCCAGTTGTTGGATCAT CAAAATGGTTTAAAAGACAATTTGGTGAAGAAAGAAATCAGTTATGCCCTGTAG
PEP MGQWLQLPGLKTALSNCCQIKPIFTKTSTAKLSFPCMPFIGGAFKKTETHVVSPNISSPS VTTGLLDAWDDEYGGVIMNSESLPMSANAFASAFQASLSNWKMKGKRGVWLKILQEQADL VPIAIQEGFNYHHAEPGYVMLTYWIPNEPCMLPASPSHQIGIAGFVINDKREVLVVKEKC PCSCCGVWKLPTGYINKSEDIFSGAIREVKEETGVDTTFLKMVAFRHAHLVAFEQSDLLF VCMLKPLSYDITIDDKEIQAAKWMPLDEFIAHPYYQDDPLSKKVIEICIAAKEDRYSGFT VHASSSATISLKPPRNSDSNSFSGSRNWDTSSSGSGFKVGSFSRSLMENKPHKVVVGDAG YVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIVVHNNSPRGTHFR RAGPRQKGGYRGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHNTSKIVDSIQDRGINQ VYIIGGDGTQKGASVIYEEIKRRGLKVVVAGIPKTIDNDIPVIDSRDVDCCLIPESPFYL EGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSESMHSMAKQDASGNKLLQDVGLWISQ KIKDHFSKRNKMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGP VNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPSFLSAKDVVEDKKEELPSQLLDH QNGLKDNLVKKEISYAL


| Top |