Cherry SNP DataBase

Gene information

Gene Pav_sc0000212.1_g1430.1.mk
Chromosome name PAV_r1.0chr7
start 16686317
end 16688446
PAV_r1.0 name Pav_sc0000212.1
start 759123
end 761252
direction -
Annotation NR PREDICTED: probable caffeoyl-CoA O-methyltransferase At4g26220
Sequence CDS ATGGAGCACAACCTGAAAAAGGAATCAGATCCTGCACAAAAGGGACTGCTGCAGAGTGAT GAGTTATATCAGTATATCTTGGAGACTAGTGTATATCCCCGTGAACCGGAGCCTCTCAAG GAGCTAAGGGCTGCCACTGCCAGCCACCCAAGGTCTCAGATGGCTACTGCACCAGATGCA GGTCAGTTAATGACTATGCTGTTGAAGCTAGTAGATGCAAAGAAGACAATCGAAGTTGGT GTTTTCACCGGATACTCTCTTCTCCTCACAGCTCTTACAATTCCTGAGGATGGCAAGCAC GAAAATAAAGGCAGTTTCGACTTTGCTTTCATTGATGCCGACAAGGTGAACTATTGGAAT TACCATGAGAGGTTAATGAAGCTGTTGAAGGTGGGTGGCATAGTTGTCTATGATAACACC CTCTGGGGAGGAACAGTTGTAATGCCTGAGGAATCGACTCCAGAATACATGAAACAAGGC AGACAGGCGACTATTGAGCTTAACAAGTTACTTGCTGCTGATGCTCGTGTCCAAATTTCA CATGCTTCTTTGGGTGATGGGATCACAATTTGCAGGAGAATTCACTGA
PEP MEHNLKKESDPAQKGLLQSDELYQYILETSVYPREPEPLKELRAATASHPRSQMATAPDA GQLMTMLLKLVDAKKTIEVGVFTGYSLLLTALTIPEDGKHENKGSFDFAFIDADKVNYWN YHERLMKLLKVGGIVVYDNTLWGGTVVMPEESTPEYMKQGRQATIELNKLLAADARVQIS HASLGDGITICRRIH


| Top |