Cherry SNP DataBase

Gene information

Gene Pav_sc0000212.1_g1890.1.mk
Chromosome name PAV_r1.0chr7
start 16475234
end 16477143
PAV_r1.0 name Pav_sc0000212.1
start 970426
end 972335
direction -
Annotation NR PREDICTED: GATA transcription factor 21
Sequence CDS ATGGCTCCACCTTCCCCTTTTCTTGAGCTCAGTGGAGATGGTGGAGATCATGATCATCAA TACCACCATCTCTTCAATCTAGAACCTCAAACTTCTTTCTCTTCTTTCTCTTCTTCCTCT CTTTCCAGCCCCATATTCTTAACTCCATCTCAAGCCCAAGCACCATCCGATCACTATAGA GAACCACAAAACTTTCAATTCCAACTCCTAGAGGCTGATCATCATAACATTGTCTCGTAT GGCGGATCATGTGATCACGACCCTAAAACCCTCGAAAACGAAAGTGGCAGTGGTACTATT CTGAAATTAAGCATTTCCAAGAATGGAGCTGGCAGAAATGGAAATCCAAGTACTGATAAG TGGATGTCTTCAAAGATGAGGATGATGAGGAAGATGACAAACCCGGATCAAACTTCGAGC AGCTGTACATCCAGCGATGATAAACCAGTTGCAATGAAGTTATCAATATCACACAAGTCT GAAGAGCAGAAGCCGCAGCATCTTGACATGATCAGCTGCAGCAACAATTCATCAAACAAC ATGAACAACAACGTCCCAATTATTAGGGTTTGCTCTGATTGCAACACTACTAAGACACCT CTATGGAGGAGCGGACCAAGAGGCCCCAAGTCACTTTGCAACGCCTGTGGAATTCGGCAA AGGAAGGCGAGGCGGGCCATGGCGGCTGCTGCAGCTGCAGCAAGCGGCACAACCCTGGCT GCTGCGCCATCTATGAAGAGTACTAGTAAGGTGCAACACAAAGACAATAAACCAAGAGTT GCTTCTACTGTCCCGTTCAAGAAAAGGCCGTACAATAAACTCAGCTCAACCCCATCATCA AAAGGCAGACCACCAAAGAAGCTTTGTTTTGAGGATTTCGCAATAAGCATGAACAATAAC CATTCATCATCTGCCACTAGCACCACCACTACTAGCCTTCAACGAGTTTTCCCACAAGAC GAGAAGGAAGCTGCGATCCTGCTCATGGCTCTATCTTGTGGACTTGTTCATGGTTGA
PEP MAPPSPFLELSGDGGDHDHQYHHLFNLEPQTSFSSFSSSSLSSPIFLTPSQAQAPSDHYR EPQNFQFQLLEADHHNIVSYGGSCDHDPKTLENESGSGTILKLSISKNGAGRNGNPSTDK WMSSKMRMMRKMTNPDQTSSSCTSSDDKPVAMKLSISHKSEEQKPQHLDMISCSNNSSNN MNNNVPIIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKARRAMAAAAAAASGTTLA AAPSMKSTSKVQHKDNKPRVASTVPFKKRPYNKLSSTPSSKGRPPKKLCFEDFAISMNNN HSSSATSTTTTSLQRVFPQDEKEAAILLMALSCGLVHG


| Top |