Cherry SNP DataBase

Gene information

Gene Pav_sc0000212.1_g710.1.mk
Chromosome name PAV_r1.0chr7
start 17060462
end 17069006
PAV_r1.0 name Pav_sc0000212.1
start 378563
end 387107
direction +
Annotation NR PREDICTED: cell division cycle protein 27 homolog B
Sequence CDS ATGGAAGCCATACTCAGAGACTGTGTTCAACACAGTCTTCGCGATTTCATGTACCGAAAC GCCATTTTCCTCTGCGAAAGACTCTGTGCCGAGTACCCATCCGAGACAAATTTACAATTG TTAGCTGGCTGTTACTTGCAAAGCAATCAAGCTTATGCTGCTTATCATATTTTAAAGGGA ACACAAGTGGCTCAATCCCGCTACTTGTTTGCAATATCATGCTTTCAGATGGATCTTCTT AGTGAAGCAGAAGCAGCATTATGTACTGTTAATGAGCCTAGTGCAGAGGTTCCAAATGGT GCAGCTGGTCATTACCTTCTGGGGCTTATTTACAGGTATACTGATAGGAGGAAAAGTGCC ATCCATCACTTCAAACAGGCTTTGACTATAGATCCTTCTATGTGGGCTGCATATGAAGAA CTGTGCGTGCTAGGTTCCGCTGAAGAAGCAGCTGTAGTTTTTGGTGAAGCTGCTTCTCTT TCCATACAAAAGCAGTATCTACATCATGGATTAGCTTCTCAAAGTTTACTTACCTTAAAT GAGGACTGTAATTTAGTTTCTGCTAGGAACTTTAGCTCGGAAGATGTTAGTCAGAGACAA TTCAAGCACATGCAAGGAAATAACATAAGAGATGTGTCTGGAAATTCTCATGTTATTTTG GGAGGAGCTTCTGGCCATCCTATGAATGGCAGTTCTAGCCTGTCTTTCTATAACACTCCT TCACCAATGCCCATGCAGTTGTCAGGTGTTGCTCCACCAGCTTTGTGTAGAATGGTACAG CCAAATGGCCCAAATATGAGCACAGGTACTGATAGCTCTCCGAGGTCAACTGTAAACTCT ACCATTCAAGCCCCTAGAAGAAAGTTTGTTGATGAAGGAAAACTGCGGAAGATTTCAAGC AGGTTGTCTTTTGATTCTGGCAACCGACGGAGCAATAGACTTGCTGCCGAAGCGGGGGCT AACACTAATCCAAGTGCCTCAATGACAGCCGGAAATGGAACTATCAATTCATCTAAATAT CTTGGAAGTTCCAAGCTGAGCTCTGTGGCACGTTCCTTGGCAAATCGTAAGGGACAGCCA TGGGCCAATGAAAATATTGATGAAGGAATACGTTATTTTCCGCTCTATGATACTGTTGAT TCCTCGATGTTTGCTCTGTCCAATAGCTTTTCAGCTGATACTTCAGTAGCTTCTGGTTTT ACTCCCTCTAGTGATAACAGATATCTTGAACAAGAAGGAGCAACCTTGTCGGGTAGTGGG GGTATTATGAATGTTTCAAGAGTTGTCACTGGTGCTTCAGAAATATTGAGCCTTTTAAGA ACCCTTGGGGAGGGCTATAGACTTTCCTGCTTGTACAGATGTCAGGATGCACTGGATGTC TATCTCAAACTTCCATACAAGCATTACAACACAGGCTGGGTACTTTCCCAGGTTGGAAAA GCTTATTGTGAACTGCTAGAATATGCAGAAGCTGATCGGGCCTTCAGTCTTGCCCGTCAA GCATCACCTTACAGTTTAGAAGGAATGGATATATATTCCACAGTTCTCTATCATGTGAAG GAAGACATGAAGTTAAGTTACCTGGCTCAGGAACTGATAGCAACCGACCGCTTAGCTCCT CAATCTTGGGTTGCGATGGGAAATTGTTATAGCTTGCAGAAAGACCATGAAACTGCTCTC AAGAATTTCCAGCGAGCTGTTCAACTTAATTCAAGATTCACATATGCACATACCCTTTGT GGTCACGAATATGTAGCTCTAGAGGATTTTGAGAATGGAATAAAGAGCTATCAGAGTGCA CTTCGTGTTGATGCAAGGCATTATAACTCCTGGTATGGGCTTGGAATGGTATATCATCGC CAAGAGAAGTTTGAGTTCGCCGAGCATCACTTCCGGACGGCTTTCCAAATAAATCCTCGT TCTTCTATTATTATGACTTACCTTGGCCAAGCATTGCATGCTTTAAAGAGAAGTGAAGAA GCGTTAGTGATAATGGACAAGGCTATTATAGCAGATAAGGAGAATCCGCTTCCCATGTAT CAGAAGGCTAACATACTAATGAGTTTAGAAAGATTTGATGAAGCTTTAGCAGTTTTAGAG GAGGTTAAAGAATATTCTCCTCGTGAAAGCAGCGTGTATGCGTTGATGGGTAAGATCTAT AAGCGACGTAACATGCATGAGAAAGCAATGCTTCATTTTGGTTTTGCCTTGGATTTGAAG CCGTCAGCAACCGATGTTGCTACTATTAAGGCTGCTATTGAGAAGTTACATGTACCAGAT GAAGATGACGACGTGTAG
PEP MEAILRDCVQHSLRDFMYRNAIFLCERLCAEYPSETNLQLLAGCYLQSNQAYAAYHILKG TQVAQSRYLFAISCFQMDLLSEAEAALCTVNEPSAEVPNGAAGHYLLGLIYRYTDRRKSA IHHFKQALTIDPSMWAAYEELCVLGSAEEAAVVFGEAASLSIQKQYLHHGLASQSLLTLN EDCNLVSARNFSSEDVSQRQFKHMQGNNIRDVSGNSHVILGGASGHPMNGSSSLSFYNTP SPMPMQLSGVAPPALCRMVQPNGPNMSTGTDSSPRSTVNSTIQAPRRKFVDEGKLRKISS RLSFDSGNRRSNRLAAEAGANTNPSASMTAGNGTINSSKYLGSSKLSSVARSLANRKGQP WANENIDEGIRYFPLYDTVDSSMFALSNSFSADTSVASGFTPSSDNRYLEQEGATLSGSG GIMNVSRVVTGASEILSLLRTLGEGYRLSCLYRCQDALDVYLKLPYKHYNTGWVLSQVGK AYCELLEYAEADRAFSLARQASPYSLEGMDIYSTVLYHVKEDMKLSYLAQELIATDRLAP QSWVAMGNCYSLQKDHETALKNFQRAVQLNSRFTYAHTLCGHEYVALEDFENGIKSYQSA LRVDARHYNSWYGLGMVYHRQEKFEFAEHHFRTAFQINPRSSIIMTYLGQALHALKRSEE ALVIMDKAIIADKENPLPMYQKANILMSLERFDEALAVLEEVKEYSPRESSVYALMGKIY KRRNMHEKAMLHFGFALDLKPSATDVATIKAAIEKLHVPDEDDDV


| Top |