Cherry SNP DataBase

Gene information

Gene Pav_sc0000214.1_g050.1.mk
Chromosome name PAV_r1.0chr8
start 7403464
end 7408924
PAV_r1.0 name Pav_sc0000214.1
start 23957
end 29417
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103335797
Sequence CDS ATGGATCTAGCTGATGAAATACCGGTCAACAACACAGAGGCAGAGGAAATGGACAGAGAG GCCTCGGCAGAAGCTCCTCTCAGAGAGTCCCATCTCTACCGGAACCAGTTTGGGGGCATG GTGAGAAAAAAAGCCTATATCTTTGATGGTTTTGGAAAGTTTTACAATAAGGAATGGGAT CTTACAGAAGGTAGAGGAAATGAGTTTTGTTGGTATCATGTGGAACTTCCAAAAGGAAAT CAGAAACTTTCTCAATCTGCACAATACCTCATTGGTGTTCTTTGCCCGCCTTTGAAACTC CAAGACATTCTCTCTCTTGTCAGCAATGGACCATTTTGTGGGCATGTTGATGGGGCTCTT GTTTTCAGAGTCAACTCTCCTGGCCCTCCATCCAGTGATTTTACATTTAGAATTGCCGCA AGAATTACTGAGAATGCAGTAATCACCGTGAGTTTGGGCCGTGTCCCCAGATTGGGTTTC TCACCAGTAGGTCAATCTCTTCTCTCAGAGATTCCTAGTGTGGAGAGTCCCTCTTATCAT AGAGGTGAGCATAGGGAAAGGAGTGGGATTGTTATAGGGGAGCATGTTCTTGAGTTCTTA TTGACAATGAATCACTCTGAGGAAGCCGATAATCCAGTGCCAAAATCTGTGTCAAATCTT GTAGTTCATATTGTTGACACGCATGTTGATCACCTCCAAGATGTTGTGACTAAACTTGAG ATAGAATTGGATTCCGTTGAGCTTCAGCTGGATAAAGGTGGTTTTGCTTTGAAGAAACAA ATGCTAGATGACAGAAGATTTCCTAAAATACATCTAGATCTGCAGCGCCTCCTGCAGGTG ATTGCTCATGGGGAGCAAGTTTTTCCTCGGGTCAAAGAAAAATGTTCCTCAAAACATTGG TTTTCCAGTGAAGATATTATCTCTCTTGAAGAGCTGATCGGACGGTTGAGGAGGCTAAAA GACAATGTAGGCTTTATAGCAAATCGTGTCACGGCAATACAGGCTGGTCTAGACAGCTGG CAAGCGGAGCAGATAAACAGGAAACTGTATTATCTCTCATTCCTTTCTATAATATTCCTT CCTTTATCCATCATTACTGGAGTGTTTGGCATGAATGTAGGGGGAGTTCCATGGACGGGA CAAAAAGACCCAACGTTGAAAGATGGTTTCCGTAATGTCATGTTTCTCTGTGTAGCTATG CTACTTCTGGCACTGCTCTGCTTCAGCTTTCCTTCTCTGTATACCCGAATAGCTACTTGG CACAGGACAAGAGCCATGAAGAGAAGCTGGTCCCTCAACAGGAAATCATTCCTCAGGAGA ACCCATGGAATTGGAGTTCAAGAAAGAAGGGGCTACCTTCGGATTTGA
PEP MDLADEIPVNNTEAEEMDREASAEAPLRESHLYRNQFGGMVRKKAYIFDGFGKFYNKEWD LTEGRGNEFCWYHVELPKGNQKLSQSAQYLIGVLCPPLKLQDILSLVSNGPFCGHVDGAL VFRVNSPGPPSSDFTFRIAARITENAVITVSLGRVPRLGFSPVGQSLLSEIPSVESPSYH RGEHRERSGIVIGEHVLEFLLTMNHSEEADNPVPKSVSNLVVHIVDTHVDHLQDVVTKLE IELDSVELQLDKGGFALKKQMLDDRRFPKIHLDLQRLLQVIAHGEQVFPRVKEKCSSKHW FSSEDIISLEELIGRLRRLKDNVGFIANRVTAIQAGLDSWQAEQINRKLYYLSFLSIIFL PLSIITGVFGMNVGGVPWTGQKDPTLKDGFRNVMFLCVAMLLLALLCFSFPSLYTRIATW HRTRAMKRSWSLNRKSFLRRTHGIGVQERRGYLRI


| Top |