Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g160.1.mk
Chromosome name PAV_r1.0chr1
start 22614732
end 22621740
PAV_r1.0 name Pav_sc0000220.1
start 55639
end 62647
direction +
Annotation NR PREDICTED: NAC domain-containing protein 68-like
Sequence CDS ATGGCATTACCTTCCCCACAATCGACTTCTCAAGTTGCTGAAACTGAAAAAGATTTTGAT TTGTTGAAGTGTTCGAAGATCGAAAACGGGAAGAAAGAAGCAGAGATCCATTTAGTAGGG TATCGGTTTGATCCGTCCGAAGATCAGATTGTTGTATTCTATCTGTTCAACAAGATTTTG GGCCGGGAACTTCCTATCAACGACATTATAAAAGAGATTTCTGTTTATGAACATGATCCG GATGAGCTCCCCAATGGTGATTTCAAACATGGTGTTGACTGCAATGAGGCCTTTTACTTC GCATATACAGAACAGGTTTACAGCAGTAGAGGGAAGATAACTAGAAGGACGACAAAGAGT GGTTACTGGGACTTAGATGGTGAGGAAGAAGAGGTTAAATACGGCAATGGCGACATAACT GTCGGGTTCGAAAAAGTTATGAACAAAGCTTCTCCCACAACTCACCAACTCAAACTCAAA CTCAAACTCAAACCCACACCAAAGCTCAGGTTATCAGTGTCCTCTCTCTTCATGGCATTA CCTTCCCCACAATCGACTTCTCAAGTTCCTGAAACTGAGAAAGATTTTGATCTGTTGAAG TGTTCGAAGATCGAAAACGGGAAGAAAGAGGCAGATGTCGATTTACCAACAGGCTATCGG TTTGATCCGTCCGAAGATGAGATTGTTGTGTACTATCTTTTCAACAAGATTTTGGACCGG GAACTTCCTATCACCGACGTTATAAAAGAGATTTCTGTGTATGATCATGATCCGGATGAG CTCCCCAATGGCGATTTCAAACATGGTTGTGACTGCAACGAGGCCTTTTACTTCACATAT ACAGAACAGATTTACAGCAGTGAAGGGAAGATAACTAGAAGGACGACAAAGAGTGGTTAC TGGGACCTAGATGGTGAGGAAGAAGAGGTTAAATACAGCAATGGCGACATAACCGTCGGA ATTATACACGAAGGAATTTCAAATTATCAGCCCACATTCAAACTTCCACCAGGATGGACA ACTAGGCCTGTTGATGAAGGAGAACCAAATTGA
PEP MALPSPQSTSQVAETEKDFDLLKCSKIENGKKEAEIHLVGYRFDPSEDQIVVFYLFNKIL GRELPINDIIKEISVYEHDPDELPNGDFKHGVDCNEAFYFAYTEQVYSSRGKITRRTTKS GYWDLDGEEEEVKYGNGDITVGFEKVMNKASPTTHQLKLKLKLKPTPKLRLSVSSLFMAL PSPQSTSQVPETEKDFDLLKCSKIENGKKEADVDLPTGYRFDPSEDEIVVYYLFNKILDR ELPITDVIKEISVYDHDPDELPNGDFKHGCDCNEAFYFTYTEQIYSSEGKITRRTTKSGY WDLDGEEEEVKYSNGDITVGIIHEGISNYQPTFKLPPGWTTRPVDEGEPN


| Top |