Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g1790.1.mk
Chromosome name PAV_r1.0chr1
start 21845337
end 21850200
PAV_r1.0 name Pav_sc0000220.1
start 827179
end 832042
direction +
Annotation NR PREDICTED: myb-like protein Q
Sequence CDS ATGCCGCAACAGGAGCCAAGGAAGAAGCTTGGAAATGAATATTCTAATTCCAAGAAGAAG GAGCGCCACATAGTTACCTGGTCTCAAGAGGAGGATGACATTCTGCGCAACCAAATTAGC GTTCATGGAACGGACAATTGGGCTATCATTGCGTCTAAATTCAAGGATAAAACAACGAGA CAGTGCAGGAGAAGATGGTACACATACTTGAATTCTGACTTCAAGAAGGGAGGGTGGTCA CCAGAGGAAGACATGCTCTTATGCGAGGCTCAAAAGATATTTGGTAACAGATGGACAGAA ATAGCCAAGGTGGTTTCGGGAAGAACTGACAATGCTGTGAAAAACCGGTTTTCGACCTTG TGCAAGAAGAGAGCCAAATATGAGGCCTTAGCTAAAGAGAACGCTACTTCATACATCAAT TCAAATGACAAAAGGGTCATAATCCGAAATGGTTTCAATACAGATGGAACAACAGAAACT ACAGCACCTTCTCAGAAGATGAGGAGAACCCACATCCCTAATCTCTCCGAAAATTGTAAC TCTGGGGACAGACTATTTGAGCAGTGTGGAAAGATGAATCAGCAGCTAAGAGCTCCATTT ACTGTGTTGATTCAGAATTTCCACAATGTAGACAACCTGCCAGACCAGCATAATGTCAGT AGCACCAAGGAAGTCCCTGGGAATGCAGCACAAAATAGCAAGTTTCAAGGATCATTTCTC AAGAAGGACGATCCGAAGATAACTGCTCTGATGCAACAAGCAGAGTTGCTCAGCTCATTG GCACTAAAAGTTAACACAGAGAACACAGACCAGAGTCTTGAAAATGCTTGGAAGGTGCTC CAGGATTTCTTGAATCAAAGCAAAGAAAGCGACATCCTCAGTTATGGAATTACTGATTTT GATTTTCAACTCGAAGATCTTAAATATCTGTTAGAGGACTTAAGGAGTACTAATGAAGGA AGTCGACCATCTTGGCAGCAACCAGATCTATACGATGAGTCCCCAGGAAGCTCTGAATAC AGTACAGGGTCAACTCTCCTGTCCCAAACAGAATGTTATGTGGAACAAAACGAAGCTGAA ATAGGTACACTGATTGAGGAGATTCAACCTGGATCACAATCCATTCCTATTGGAGGGGAA AATGATGTTCGTGAATGTGAGAAAGGGATTGTTTCCAGTGGAACCAGAAAGCAAGAGATA TTTCCATCTTGTAATGAAGGAACAAAAACTGATGCAGTCATTTCTGTATCGTCAAATACA GAGTTCAGTTCTCCTAATCAAGTTACCCCGTTGTTCCGATCTTTGGCAGCAGGAATTCCC AGCCCAAAATTTTCTGAAAGTGAAAGGAGCTTCTTGCTCAAAACGCTTGGAGTGGAGTCT CCTTCTCCTTACCCAAGCAACAATCCTTCACGACCACCACCCTGCAAACGAGCCCTCCTT CAAAGTCTATAA
PEP MPQQEPRKKLGNEYSNSKKKERHIVTWSQEEDDILRNQISVHGTDNWAIIASKFKDKTTR QCRRRWYTYLNSDFKKGGWSPEEDMLLCEAQKIFGNRWTEIAKVVSGRTDNAVKNRFSTL CKKRAKYEALAKENATSYINSNDKRVIIRNGFNTDGTTETTAPSQKMRRTHIPNLSENCN SGDRLFEQCGKMNQQLRAPFTVLIQNFHNVDNLPDQHNVSSTKEVPGNAAQNSKFQGSFL KKDDPKITALMQQAELLSSLALKVNTENTDQSLENAWKVLQDFLNQSKESDILSYGITDF DFQLEDLKYLLEDLRSTNEGSRPSWQQPDLYDESPGSSEYSTGSTLLSQTECYVEQNEAE IGTLIEEIQPGSQSIPIGGENDVRECEKGIVSSGTRKQEIFPSCNEGTKTDAVISVSSNT EFSSPNQVTPLFRSLAAGIPSPKFSESERSFLLKTLGVESPSPYPSNNPSRPPPCKRALL QSL


| Top |