Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g2620.1.mk
Chromosome name PAV_r1.0chr1
start 21502168
end 21510736
PAV_r1.0 name Pav_sc0000220.1
start 1166643
end 1175211
direction -
Annotation NR PREDICTED: hypersensitive-induced response protein 2
Sequence CDS ATGGCACGATTTGCAGACGAACGCTTCCAGTTCCGAGAGAAAATGGGACAAGCTCTTGGT TGTGTTCAAGTGGACCAGTCTACTGTTGCTATCAGAGAAACTTTTGGGAAGTTTGATGAT GTGCTTGACCCTGGTTGTCACTGTTTGCCTTGGTGTTTGGGTAGCCAGATAGCTGGTCAT CTCTCTTTACGTGTGCAGCAATTGGATGTTCGCTGTGAAACAAAGACAAAGGATAACGTT TTTGTTACTGTGGTTGCATCTGTTCAATACCGAGCTTTAGCTGAGAAGGCTTCAGATGCC TTTTACAAGCTCAGCAATACCAGAGGGCAGATCCAATCTTATGTCTTTGATGGTATGGAT TTGTTACCGAAATTCGCCATGTCACATTATGGGTTTGAGATAGTTCAAACACTAATTGTG GATATCGAACCAGATGAGCATGTGAAGAGAGCAATGAATGAGATAAATGCAGCTGCAAGG ATGAGGTTGGCTGCAACTGAGAAAGCTGAAGCAGAGAAGATATTGCAGATTAAGCGAGCT GAGGGAGAGGCAGAGTCCAAATATCTGTCAGGGCTTGGAATAGCAAGGCAGCGCCAGGCC ATTGTGGATGGGCTGAGAGACAGTGTGCTGGCCTTCTCTGAGAATGTGCCGGGGACATCA TCAAAGGATGTCATGGACATGGTTCTGGTGACCCAGTACTTCGACACAATGAAGGAGATC GGTGCATCCTCAAAGTCCAATTCGGTTTTCATCCCACACGGCCCCGGTGCTGTGAGAGAC ATTGCTTCACAGATACGAGATGGCCTCCTTCAAGCAAATCCACCTCAGAATCCGAAAATG GGACAAGCTCTTGGTTGTGTTCAAGTGGACCAGTCTACTGTTGCTATCAGAGAAACTTTT GGGAAGTTTGATGATGTGCTTGACCCTGGTTGTCACTGTTTGCCTTGGTGTTTGGGTAGC CAGATAGCTGGTCATCTCTCTTTACGTGTGCAGCAATTGGATGTTCGCTGTGAAACAAAG ACAAAGGATAACGTTTTTGTTACTGTGGTTGCATCTATTCAATACCGAGCTTTAGCTAAG AAGGCTTCAGATGCCTTTTACAAGCTCAGCAATACCAGAGGGCAGATCCAATCTTATGTC TTTGATGTTCAAACACTGATTGTGGATATCGAACCAGATGAGCATGTGAAGAGAGCAATG AATGAGATAAATGCAGCTGCAAGGATGAGGTTGGCTGCAACTGAGAAAGCTGAAGCAGAG AAGATAATGCAGATTAAGCGGGCTGAGGGAGAGGCAGAGTCCAAATATCTGTCAGGGCTT GGAATAGCAAGGCAGCGCCAGGCCATTGTGGACGGGCTGAGAGACAGTGTGCTGGCCTTC TCCGAGAATGTGCCGGGGACATCATCAAAGGATGTCATGGACATGGTTCTGGTGACCCAG TACTTCGACACAATGAAGGAGATCGGTGCATCCTCAAAGTCCAATTCGGTTTTCATCCCA CACGGCCCCGGTGCTGTGAGAGACATTGCTTCACAGATACGAGATGGCCTCCTTCAAGCA AATCCACCTCAGGTGTAA
PEP MARFADERFQFREKMGQALGCVQVDQSTVAIRETFGKFDDVLDPGCHCLPWCLGSQIAGH LSLRVQQLDVRCETKTKDNVFVTVVASVQYRALAEKASDAFYKLSNTRGQIQSYVFDGMD LLPKFAMSHYGFEIVQTLIVDIEPDEHVKRAMNEINAAARMRLAATEKAEAEKILQIKRA EGEAESKYLSGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEI GASSKSNSVFIPHGPGAVRDIASQIRDGLLQANPPQNPKMGQALGCVQVDQSTVAIRETF GKFDDVLDPGCHCLPWCLGSQIAGHLSLRVQQLDVRCETKTKDNVFVTVVASIQYRALAK KASDAFYKLSNTRGQIQSYVFDVQTLIVDIEPDEHVKRAMNEINAAARMRLAATEKAEAE KIMQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQ YFDTMKEIGASSKSNSVFIPHGPGAVRDIASQIRDGLLQANPPQV


| Top |