Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g280.1.mk
Chromosome name PAV_r1.0chr1
start 22557763
end 22560514
PAV_r1.0 name Pav_sc0000220.1
start 116865
end 119616
direction -
Annotation NR PREDICTED: probable WRKY transcription factor 57
Sequence CDS ATGGACGACGACAAAGACAACCGCGATCCAGTTAGCAAGACCGAGTTCACGACTCAGTCC ACCTGGCCACTCGACTCGGACAGCGCCTACTTCTTCTCCAGCCACGACGTCAGAGACAAC ACACTCCTCACTGAATTCGGCTGGAACTTCCACCCGGACGGCTCCAGACCCGACGGCTTT TCGGAACTTGACCCGATCGGAACCCGCGACATGTCCGATTTGACGGCAACTAGTAGCCAG CTTGTTGCGGACTGCTTGCGACCCGCCGACAGCAGCAGCAGCAGCACCGCGGCGTTTCGG AGCTCCGACCCGGCCCCCGTCGTCGGATCCGCTTCGACGAACCCGTCCGTTTCGTCGACC TCCAGCGAGGATCCGCCGGAGAAATCAACGGGGTCCGGCGGCAAACCACCACCTGAGATA CCAGAACGAGTTAGTCCTGTTAACTTGACACGAACGACTTCGCACCAATTAGCATCCCCA CGTGGTGATGATGATGATGATGATGATCAAGCTGCAGGAGGAGGATCATCCCACAGCCTT GATCCACAGACAAGTGCAGTTCCTACAGATGAAGGGCTTCTTGGGGACATTGTACCTCCT GGGATGCGTAATCGATGA
PEP MDDDKDNRDPVSKTEFTTQSTWPLDSDSAYFFSSHDVRDNTLLTEFGWNFHPDGSRPDGF SELDPIGTRDMSDLTATSSQLVADCLRPADSSSSSTAAFRSSDPAPVVGSASTNPSVSST SSEDPPEKSTGSGGKPPPEIPERVSPVNLTRTTSHQLASPRGDDDDDDDQAAGGGSSHSL DPQTSAVPTDEGLLGDIVPPGMRNR


| Top |