Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g330.1.mk
Chromosome name PAV_r1.0chr1
start 22533066
end 22536444
PAV_r1.0 name Pav_sc0000220.1
start 140935
end 144313
direction +
Annotation NR PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710
Sequence CDS ATGGCGCTTCGTTTTTCGTTAGCCGCATTTTCTCTGATCCTCCTTCTATCCTATCCTCTG CTTCTCAACGCCAAAACCCTCAAACGTGACATGAAAGCATTGAACGAGATCAAGGCTTCG CTGGGCTGGAGAGTTGTGTACGCTTGGGTCGGAGACGATCCGTGCGGAGACGGCGACCTT CCGCCGTGGTCCGGCGTCACTTGCTCAACTCAAGGCGATTATCGAGTCGTCACTGAGTTG GAGGTTTATGCAGTCTCAATTGTTGGGCCTTTTCCAACTGCTGTCACCAATCTCTTGGAT CTCACTAGGCTGGATCTCCATAACAACAAGCTGACGGGCCCTATTCCCCCCCAAATTGGA CGTTTGAAGCGTCTTAAAATGCTTAATTTGAGATGGAATAAGTTACAAGATGTCATTCCT CCCGAAATTGGTGAACTGAAGAGTTTAAACCATTTGCATCTAAGCTTTAATAGTTTCAAA GGGGAAATTCCAAAGGAGCTTGCTAATCTTCCAGAGCTTCGCTATCTCTATCTGCAAGAA AATCGTCTTATTGGGCGGATTCCTGCAGAACTAGGAACTTTGCAAAATCTTCGGCACTTG GACGTTGGTAATAATCATTTGGTGGGTACCATTAGGGAACTCATACGCATTGAGGGCTGC TTTCCAGCTTTGCGTAACCTTTACCTGAACAACAACTATCTTACGGGAGGAATTCCAGCA CAGCTTGCAAACTTGACCAAGTTGGAAATCTTGTACCTATCTTACAACAAGATGTCTGGG ATAGTTCCATTAGGACTTTCCCATATTCCGAGATTGACTTACTTGTATTTGGATCACAAT CAATTTTCAGGGAGAATTCCCGATGCCTTCTATAAACACCCATTCTTGAAAGACATGTAT ATTGAAGGGAATGCATTCAGACCAGGTGTGAAACCGATAGGCATACACAAAGTTCTTGAG CTCACTGACACGGAATTTCTTGTTTAG
PEP MALRFSLAAFSLILLLSYPLLLNAKTLKRDMKALNEIKASLGWRVVYAWVGDDPCGDGDL PPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIG RLKRLKMLNLRWNKLQDVIPPEIGELKSLNHLHLSFNSFKGEIPKELANLPELRYLYLQE NRLIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPA QLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMY IEGNAFRPGVKPIGIHKVLELTDTEFLV


| Top |