Cherry SNP DataBase

Gene information

Gene Pav_sc0000220.1_g630.1.mk
Chromosome name PAV_r1.0chr1
start 22388323
end 22393742
PAV_r1.0 name Pav_sc0000220.1
start 283637
end 289056
direction +
Annotation NR PREDICTED: probable protein S-acyltransferase 22
Sequence CDS ATGAGGAAGCATGGATGGCAACTACCTTACCATCCTCTCCAGGTGGTGGCTGTTGCTGTA TTTCTGGCGTTGGCCTTTGCTTTCTATGTGTTCTTTGCTCCTTTTGTTGGAAAGAGGATT TTTCAGTATGTTGTGATGGGCCTCTACACTCCTCTTATTACATGTGTCTTCGGCCTATAT ATTTGGTGTGCAGCTGCTGATCCTGCAGACCCAGGAGTTTTTAGGTCAAAGAAATATCTC AACATTCCTGCCGATGAAAAGCATAATAGAACAAAAGATTCTAAACTATGTGGGGAGTCA ACATCATCAATGCATGATGCTAATGCTGTAACAGTTGGAGGAAAACCTCTGGATAAGGAT GGTTTGGGCAAAGACGCGACTTCCAAAATGTCCGCCAGTGAAGGTGGAACAAAGAATGAA TCAGAACATTCATCGTGCTTCCTGTTGGCTTGCTCTCCGTGTGCATATATCTGCAATTGC TCCAGTTCGAGTGAGGAATCTTCTGTACAACAAATGAGTGAAGAAGGCATGTTCTATTGC AGTTTGTGTGAAGTTGAGGTTTTCAAGTACAGCAAACACTGCAGAGTTTGTGACAAATGT GTTGACCGGTTTGATCATCACTGCCGGTGGCTTAACAACTGTATTGGAAAAAAGAATTAC CGACAATTTTTCACGCTTATGGTTACTTCTCTCCTCTTGGTAAGCATAACCTTCCAACCT TATAACCCGCCTTTGAGAGTGCTCCCGTTCCAGACACATGGATCTTCTTTTCGCCATTCA GCCATATCAAGGTATGTACATGGTTTGTACACCTTGGGGTTGAGATTGCAGCTTATTTTA CAATGGTCAACTGGAATCTTCGTGCTTATCTGCTGTATTGTTGAGAGGAAGCAGTTCTCT GTGGATATTTCTACCAAGTTGGGGAGCAGTTTCTCTTTGGCACCTTTCATTATTGTGGTG GCGGTGTGTACCCTTTTGGCTATGATTGCAACCTTGCCACTTGCACAACTTTTCTTTTTT CACATCCTCCTTATAAAGAAGGGAATCAGCACGTATGATTACATCATTGCTTTGAGGGAG CAGGAGCAAGAGCAACAAGGAGTTGGAGGTCAGCATAGTCCCCAAATGTCTCCTGCTAGC TCACTTACTGGATTAAGCAGTGCAAGCTCCTTTACTACTTTCCACCGAGGTGCATGGTGT ACACCTCCACGTCTGTTCCTTGAAGATCAGTTTGATGTTGTGCCCCCAGAGACTGGATCT GTCAGTTCGTATGGAAGAAAGGTGGTGGGAGAGGAACCAGTTAAGAAGAAGAATACAGCA GTAAAGATCAGTCCGTGGACTCTGGCAAGATTAAATGCTGAAGAGGTATCAAAAGCTGCG GCAGAGGCAAGAAAGAAGTCGAAGATCCTGCAGCCTGTGAGACGTGATGCTCCTTTTGGG CTAGAAAGAGACAGCAGCTTTGGCAGCAGTGGCCGCCGAATGGTTCCAAGGCCTGACAAT AATCGAAGGCGAACTACGAAGCGGGTGCGCCTCCCAGCCGACCTTCCCATGGATGCTTTG ACAAAGGGTTCGGCTAAAGCTGTTGACAAAGGCTTTACTGAGACATCAACTAGTTTGGCC CCTCTTCAGCTTGAAGCTCGGAGTGCTTTCCAAACAAGCCGAGCAATGTCAAGCTCCACA GGGATTGTTGCTTCTTCTCCTGATAGCAGTTTAGACTCACCTGACATCCATCCCTTCCGG GTGTCCTCATCAGGAGCTGAAGAGGCAAGGCGGCTTACGGGTCTGCCTGCTGCTGTTGCT GCTGGTCAGAAGGGAATGCCACTATCAAGATCAACCAGTGATGGGTATGACGCATCTGGT GGAGAAGATAGTGATAGAGTTCCTTCTAGAATCGTCCAAAGGGCTTCATGGGGACTATCT GAATGGCAAGTTTGCTGTCACAATACTCGATCGGCTGTTTTGGCTTGCGTGGTCTATTGT TAA
PEP MRKHGWQLPYHPLQVVAVAVFLALAFAFYVFFAPFVGKRIFQYVVMGLYTPLITCVFGLY IWCAAADPADPGVFRSKKYLNIPADEKHNRTKDSKLCGESTSSMHDANAVTVGGKPLDKD GLGKDATSKMSASEGGTKNESEHSSCFLLACSPCAYICNCSSSSEESSVQQMSEEGMFYC SLCEVEVFKYSKHCRVCDKCVDRFDHHCRWLNNCIGKKNYRQFFTLMVTSLLLVSITFQP YNPPLRVLPFQTHGSSFRHSAISRYVHGLYTLGLRLQLILQWSTGIFVLICCIVERKQFS VDISTKLGSSFSLAPFIIVVAVCTLLAMIATLPLAQLFFFHILLIKKGISTYDYIIALRE QEQEQQGVGGQHSPQMSPASSLTGLSSASSFTTFHRGAWCTPPRLFLEDQFDVVPPETGS VSSYGRKVVGEEPVKKKNTAVKISPWTLARLNAEEVSKAAAEARKKSKILQPVRRDAPFG LERDSSFGSSGRRMVPRPDNNRRRTTKRVRLPADLPMDALTKGSAKAVDKGFTETSTSLA PLQLEARSAFQTSRAMSSSTGIVASSPDSSLDSPDIHPFRVSSSGAEEARRLTGLPAAVA AGQKGMPLSRSTSDGYDASGGEDSDRVPSRIVQRASWGLSEWQVCCHNTRSAVLACVVYC


| Top |