Cherry SNP DataBase

Gene information

Gene Pav_sc0000229.1_g330.1.mk
Chromosome name PAV_r1.0chr5
start 12413126
end 12418043
PAV_r1.0 name Pav_sc0000229.1
start 154812
end 159729
direction +
Annotation NR PREDICTED: proline transporter 2-like
Sequence CDS ATGGAAGGAGAAGATATGACAACAAACAACAAGGAAACTTTGAGCATTGAACAAGGCCAA TTAAAGGGTGACCAAGATCATGAATTTTCCCTCCCCTCTGCTCATACCATTGGCCATGAT TCATGGCAACAAGTTGGGTTGATGCTGGTGACAAGCTTCAATTGTGGGTACATATTGAGC TTTTCAAATCTTATGTTGGTGCCTTTGGGATGGACATGGGGGATCATATGCCTGTTGGTT GTGGGGTTCTATACTGCCTATGCCAACTGGCTTTTGGCTGCTTTTCACTTCATCAATGGC CAAAGGTTCATCAGATACAGAGATCTCATGGGATTTTTGTTTGAGGAAACTGATTGTGTT TTTTCTTGTTTTTGCAATCTTATCAAAGGCAGAGAAATGTATTACATCACATGGGTTTCC CAGTTCTTGACCCTTCTTCTTGGAAATATGGGTTTCATTCTACTTGGAGGAAGAGCACTC AAGGAGATTAACTCAGAATTCAGTGATTCTCCCCTGAGGCTCCAATACTATATCGTTGTC ACTGGAGCGACCTACTTCATCTATTCATTTCTAATTCCAACAATGTCTGCAATGAGAAGG TGGCTCGGACCCTCTACCGTTCTCACTTTCGCTTACATTGTCATACTCTTGGTGGTAGTA GTTAAAGATGGGAAAGCTAACACAAAGAGAGATTATGCAATCCATGGAAACAAAGCAGAC AGAGTGTTGAATGCCTTTGGTGCAATTTCAGCTATAATTGTGTGCAACACCTCCGGCCTG CTACTGGAAATACAGTCAACTCTGCGCAAGCCTGCAGTTTCAAATATGAGGAAAGCTTTA TATCTGCAGTTTAGTGTGGGGCTGGTGTTTTACTATGGAGTCAGCATGGTGGGATACTGG GCTTATGGCTCAACTGTCTCTGAATACCTTCCTGAAGAGCTAAGCGGTCCTAATTCGGTT AAGGTCCTCATAAACGCCGCCGTTTTCCTGCAATCCGTAGTCTCTCAACATATGTTTGCT GCACCGATTCATGAGACCCTTGATACCAAGTTCCTCAAACTTGAAACTGGCATGAACACT AAAGAAAACTTGAAGAGGAGATTCTACATGCGAGCCCTTCTTTTCTCGGTGAATTCATTT GTGACAGCAGCTTTTCCTTTCATGGGGGACTTCGTGAACTTGTTTGGATCATTCACACTT GTTCCTCTAACTTTCGTGTTCCCAAGCATGATTTTCATCAAGGTGAAAGGAAAGACAGCT AGACTAGAGAAGAATTTATGGCATTGGTTCAACATTGTAATTTTTTCTCTCCTTGCTGTT GTGACCACAATTTCTGCTGTTCGATTGATCGTCAACAATGTTCAGAAATATCATTTCTTT GCAGATACATGA
PEP MEGEDMTTNNKETLSIEQGQLKGDQDHEFSLPSAHTIGHDSWQQVGLMLVTSFNCGYILS FSNLMLVPLGWTWGIICLLVVGFYTAYANWLLAAFHFINGQRFIRYRDLMGFLFEETDCV FSCFCNLIKGREMYYITWVSQFLTLLLGNMGFILLGGRALKEINSEFSDSPLRLQYYIVV TGATYFIYSFLIPTMSAMRRWLGPSTVLTFAYIVILLVVVVKDGKANTKRDYAIHGNKAD RVLNAFGAISAIIVCNTSGLLLEIQSTLRKPAVSNMRKALYLQFSVGLVFYYGVSMVGYW AYGSTVSEYLPEELSGPNSVKVLINAAVFLQSVVSQHMFAAPIHETLDTKFLKLETGMNT KENLKRRFYMRALLFSVNSFVTAAFPFMGDFVNLFGSFTLVPLTFVFPSMIFIKVKGKTA RLEKNLWHWFNIVIFSLLAVVTTISAVRLIVNNVQKYHFFADT


| Top |