Cherry SNP DataBase

Gene information

Gene Pav_sc0000240.1_g220.1.mk
Chromosome name PAV_r1.0chr1
start 8738131
end 8746176
PAV_r1.0 name Pav_sc0000240.1
start 93048
end 101093
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103322929
Sequence CDS ATGGAAGGCTCAGGGAATGAACGTTTCGATTTTGGAAAGATGGGTTACGGATGCAAGCAT TATAGAAGAAGATGCCAGATTCGAGCTCCGTGCTGCAACGAGATCTATCCATGTCGTCAT TGTCACAACGAAGCCACGAGCATGTTGAGCAACCCTTTTGATCGGCATGAGCTCGTCCGC TACGATGTTAAACAAGTTGTTTGTTCAGTTTGTGACACAGAGCAGCCGGTTGCACGAGTC TGTACAAACTGCGGCGTCAGCATGGGGGAATATTTCTGTGAAATTTGCAAATTCTACGAT GATGATGTAAGCTTACTATTTGCTCAAATTGAATTACCACTGATAAAGGGCAATTTCATT GTAATGATTGTGGGATCTGCAGGGTCTTGCTATTCAGTTGGCCTACGTGATAATCACTTG TGTGTGGAGAACTCCATGCGGCACCACTGCCCCATTTGTTATGAGTTCCTTTTCGACTCG CTGAAAGACACTACTGTAATGAAATGTGGTCACACAATGCACTGTGAATGTTACAATGAA ATGATGAAGCGTGACAAATACTGTTGTCCAATATGCTCCAAGTCAGTGATTGACATGTCC AGAACCTGGAAGAGAATAGATGAGGAGATAGAAGCAACAACGATGCCTGAGGATTACCGG TTCAAGAAGTGCCTGGGCTTTAGCTTTCTCCAAAACTCGCCGAGTTCACTCGGAGCCCCA ATATCAGACTGGACTCGGTCCTTCAAAGCCATGCAAGTGGTCTCCAATACTCGCAGGCTC TCTAGAGCTCTCAAATCTCCCATTTTTATCAAATCCGATCAATTTCTCTCTCCAGATGTC CGAGTTGTCGAAGCTCCCCTCACTTCTTTCCAATGGCGGAACCTCAGCACCGTCTCTTCG CAAAACTCCTTGTTCTTTGGCATTACTCGCGGTTCTCTTCTGCCAATGGAACAACACACA ACGTGCACAATGATGACATTGAGAGCGCACTTTTCTTCTGAAGCGAGTACCGTCGAAGGT GGTTCCACAGAGGTTGTGAAGGAGCTGTATGATAAAATGCTGCAATCTGTGAATATAAAA CGATCAATGCCCCCCAATGCTTGGTTATGGTCATTGATTGAGAATTGCAAAAAGCATGAA GATATTAAGCTTCTATTTGACATCTTGCAGAATCTACGCAGATTTAGATTGTCAAATCTT CGCATCCATTCTGATTTTAATTGCAATCTCTGCCGAGAGGTTACTAAGGCATGTGCTCGT GTGGGGGCCCTTGACTTTGGAAAGAAGGCCTTGTGGAAACATAATGTGTATGGATTGGCT CCTACCATCGGATCTGCTCACCATTTACTGATACATGCTAAAGAACGCAGTGATGCTAAA CTTATGATGGAAATAATGAGTCTTTTAAAGAAGAATGACTTACCCTTGCAACCTGGTACA GCAGATATCGTTTTCAGCATCTGTTACAATACTGATAATTGGCAGCTGATGTCTAAGTAC TCAAAAAGGTTTGTCAAAGCTGGAGTAAAGCTACGGCAAACTGCATTTGATCTATGGATG GAATTAGCTGCTAAAATAGGAGATGTTGAATCATTGTGGAAAATTGAGAAGTTAAGATCT GAGTCGATGAAGCAGCACACTGTTGCGAGTGGATTTTCATGTGCTAAGGGTTTTCTCTTA GAACATAAGCCCGAGGAAGCTGCTTCCATCATCCAAGTTCTAAATCAGGCATTAGCCGTA TCTTTAACATCCGATATTCCTGCAATGGTTAGTGGTTTATTAACCACGGGCTTACAAGTG AATGTAAACATTGAGGACCTAACCAGCAAAGAAGGTGTTCTTTATTGA
PEP MEGSGNERFDFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVR YDVKQVVCSVCDTEQPVARVCTNCGVSMGEYFCEICKFYDDDVSLLFAQIELPLIKGNFI VMIVGSAGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNE MMKRDKYCCPICSKSVIDMSRTWKRIDEEIEATTMPEDYRFKKCLGFSFLQNSPSSLGAP ISDWTRSFKAMQVVSNTRRLSRALKSPIFIKSDQFLSPDVRVVEAPLTSFQWRNLSTVSS QNSLFFGITRGSLLPMEQHTTCTMMTLRAHFSSEASTVEGGSTEVVKELYDKMLQSVNIK RSMPPNAWLWSLIENCKKHEDIKLLFDILQNLRRFRLSNLRIHSDFNCNLCREVTKACAR VGALDFGKKALWKHNVYGLAPTIGSAHHLLIHAKERSDAKLMMEIMSLLKKNDLPLQPGT ADIVFSICYNTDNWQLMSKYSKRFVKAGVKLRQTAFDLWMELAAKIGDVESLWKIEKLRS ESMKQHTVASGFSCAKGFLLEHKPEEAASIIQVLNQALAVSLTSDIPAMVSGLLTTGLQV NVNIEDLTSKEGVLY


| Top |