Cherry SNP DataBase

Gene information

Gene Pav_sc0000243.1_g080.1.mk
Chromosome name PAV_r1.0chr3
start 6760113
end 6763320
PAV_r1.0 name Pav_sc0000243.1
start 31188
end 34395
direction -
Annotation NR hypothetical protein CICLE_v10003979mg, partial
Sequence CDS ATGAAAAGGGGAAAATCATTCACGTTGGAACAAGATGTGGCTATTTGCAATGCTCGGTTA AATATCTTCCAAGATCCGTTCAATGTTGTTTCAAAACCGCAATATAATTTCTGGGATCGA ATATACCAAAATTATGGTGAGTTAACTGGGGATCAAAATGTGCGCTCCCAATGTTCAGTT CAGTCTAGGTGGAAATTAATCATCGGGAGTTGCAAAAAATTTCATGATTGTCTTGCTCGA GTAGAAGATAAACAAAGTGGATTGACTGAATCTAACAAGGTTCTTCGAGCAAATATGCTG TACTTTGAGCATGAGAAGAAACGTTTTGCATTCAATCATTGTTGGGAAATTTTGCAACAT AAGATGAAAGATTTGGCACCAGCTAAGAGTCTTGATCCTCGTACTAAGGATAGAGACTCC AACATCCATTCCTCATTCTCCTCGCATCCTCTGGACCCTAACACACTTGTTTCACCTGAA TCTGATAAAGATTCATATTATATAACGGAATCTCGAAAAAGCAAAAGGCCTGCAAGAAGA AGGGCTGAAAAAGAAGCACACAGGAGGAGCAAGGTAGTCAATACTTTGGATTCTCGCATT TGCGACTTGATGGAGCAATTTACAAAACAATTGGCAGAGAGTGACAAAAGAAAGGCAGAA GTTGCAGAAAGAAAGGTAAAGGTCATGGAGGAAATGAATGAAAGGCAGCAAAGAGAGCAA GATGACCGCATTATGAGTATGGACACTTCAAACATGGGACCACGCGCAAGAGCTTACTAT GAGCACAGAAAGAGTGATATTTATTTCAAAACCATGGGGCACACTGCAGACAAGTCCAAT ATGGAGGACAAGAGCACGATATTTATGCCAAAATGA
PEP MKRGKSFTLEQDVAICNARLNIFQDPFNVVSKPQYNFWDRIYQNYGELTGDQNVRSQCSV QSRWKLIIGSCKKFHDCLARVEDKQSGLTESNKVLRANMLYFEHEKKRFAFNHCWEILQH KMKDLAPAKSLDPRTKDRDSNIHSSFSSHPLDPNTLVSPESDKDSYYITESRKSKRPARR RAEKEAHRRSKVVNTLDSRICDLMEQFTKQLAESDKRKAEVAERKVKVMEEMNERQQREQ DDRIMSMDTSNMGPRARAYYEHRKSDIYFKTMGHTADKSNMEDKSTIFMPK


| Top |