Cherry SNP DataBase

Gene information

Gene Pav_sc0000243.1_g150.1.mk
Chromosome name PAV_r1.0chr3
start 6791895
end 6797707
PAV_r1.0 name Pav_sc0000243.1
start 62970
end 68782
direction +
Annotation NR PREDICTED: 3-isopropylmalate dehydrogenase 2, chloroplastic-like
Sequence CDS ATGGCTGCTTGTCTGCAACTCAACGCTAAACCCTTCAGCCCCCTTCTCTCTCCTAACCCC GTTTCCACACGCACCCGGAAATCGGGTAGGATCAGCTGCTCCGCAGCCTCGCCTTCCAAA CGCCACACCATTACTTTGCTTCCTGGCGATGGCATTGGCCCCGAAGTCATCTCCGTCGCC AGGAACGTTCTCAACCTCGCCGCTTCTATCGAAGGGATTGAGTTTAAGTATCAAGAACTT CCTGTGGGCGGAGCTGCATTGGATTTGACCGGAGTTCCATTACCGGAAGAGACCCTTTTG GCTGCTAAGCAATCTGATGCAGTTCTGCTCGGAGCAATTGGGGGGTACAAATGGGACAAA AACGAAAAGCATTTGAAACCAGAAACTGGGTTACTTAAGCTTCGAGAAGGTCTTAAAGTA TTTGCGAATTTGAGGCCTGCAACTGTTTTACCGCAGTTGGTGGATGCTTCAACTTTGAAG AGAGAGGTTGCTGAAGGGGTGGACCTTATGGTTGTAAGAGAGCTAACTGGAGGTATATAT TTTGGAAAGCCAAGGGGTTTTGGCACCAATGAAAACGGAGAGGAGATTGGCTTCAATACG GAGGTGTATGCCGCCTATGAGATCGATCGCATTGCTCGTGTTGCATTTGAGACTGCTCGG AAGCGGAAGGGAAAGCTCTGCAGTGTTGATAAAGCAAATGTGTTGGAGGCATCAATGTTT TGGAGGAAAAGAATCATGGCAATAGCCTTGGAATATCCTGACGTTGAACTCTCACACATG TATGTTGATAATGCTGCAATGCAGCTTGTTCGTGATCCAAAACAGTTTGATACGATTGTA ACAAACAACATATTTGGCGATATATTATCCGATGAGGCGTCGATGATTACTGGAAGTATT GGGATGCTTCCATCTGCTAGTCTTGGGGAATCGGGTCCTGGACTTTTTGAACCCATACAT GGTTCTGCTCCTGATATTGCTGGACAGGATAAAGCAAATCCATTAGCAACAATTCTCAGT GCTGCTATGCTTTTAAAGTACGGTCTAGGGGAAGAAAATGCTGCCAAGAGAATTGAGGCT GCAGTTCTAGATACTTTGAATAAGGGGTTTCGAACGGGTGACATATATTCCGCAGGAACT AAATTGGTAGGGTGCAAAGAAATGGGTGAAGAGGTATTGAAGTCGGTAGATTCGCTAGTT CTTTCTCCAGTATGA
PEP MAACLQLNAKPFSPLLSPNPVSTRTRKSGRISCSAASPSKRHTITLLPGDGIGPEVISVA RNVLNLAASIEGIEFKYQELPVGGAALDLTGVPLPEETLLAAKQSDAVLLGAIGGYKWDK NEKHLKPETGLLKLREGLKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGGIY FGKPRGFGTNENGEEIGFNTEVYAAYEIDRIARVAFETARKRKGKLCSVDKANVLEASMF WRKRIMAIALEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITGSI GMLPSASLGESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEENAAKRIEA AVLDTLNKGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSLVLSPV


| Top |