Cherry SNP DataBase

Gene information

Gene Pav_sc0000243.1_g160.1.mk
Chromosome name PAV_r1.0chr3
start 6799665
end 6805471
PAV_r1.0 name Pav_sc0000243.1
start 70740
end 76546
direction +
Annotation NR PREDICTED: BRCA1-associated protein
Sequence CDS ATGTCACCGAGTTCGAGCACGGCACATGCCGGAGCCTCGCCCGGCGAGGTTTTCAGGTCG CAGCCGGTCATTATCTCTGGCGATCCCAGTGACTCCTCATATTCGTCGTCTTCCTCAATC TCCAACATCACGCAGGCCTTTCCTTTCTCTTCTGGAAACCCTAGAATCGAAGAGACCAGA GGCATCATGCTTCTCTACCGCGATGACGCCGACGTCGTTTCCACCTCGCCCTCTCACCTC CCCGTTGGAAGGAAGCCACTTGTTTGTGTGCTTGGAGTGCCGAATCACATGACATATGCA GACTTTTGCCAGTTTTGTGGTTCATTCATTCAGCATATTTTGGAGATGCGGATTGTCAGG AATGATGGAATGGAAGATCGTTACAGCATTTTGATTAGGTTTGATAGTCAGGACTCCACA GATGATTTTTACAAGCATTTCAATGGAAGTCGATTTTCGTCGCTTGAGGTGGAGGCTTGT CGCATTCTCTTCACGGTAGATGTTCAATACACTGGTTCAATAGAACATGCACAGGCATCA TCGGGAAGCTCAACTGAGCAGCCATCATGTCCAGTCTGTCTTGCTGCAGTCTATGATTTG GCTACAGCTTTTGTTCTTCAAATTTGTTACGTTCACTTTCCTGCTAGCGTATGTCGATAT TGTCAGCAGCAGCCTGAAAAGTCTAACTGTTTTGTTTGCCAAACTTCTGAGAATTTGTGG ATGTGTGTTATCTGTGGCTTTGTTGGCTGTGGGAGGTATAAAGAAGGACATGCCATAAGA CATTGGAAAGATACAGAACATTGTTATTCTCTTGAATTGGAAACGCAGCGTGTGTGGGAT TATGCTGGAGACAATTATGTTCACCGCCTAATTCAATCTAAAACTGATGGGAAATTGGTT GAATTGAATTCACCGTATAATGAGTGTGGAAGTTGCGAATGTGTAGATTCTGGATTCAGT GAGGCCCTTTTGAACAGTAAAGTAGAAGCGATTGTTAACGAGTACAATGAACTGCTTGCT ACTCAACTTGAGAACCAAAAAGTGTATTTTGAATTGTTACTGCAAGAAGTTAAAGAAGAA ACTGAAAGAGAAATTTCTAATGCTGTTGAGAAGGCTGTACCACTAAAGAAAATGCAGGCC AAGCTGGACAGATGTGTAAAAGAGAAGAAATTTCTTGATGATCTTAATGAAAACCTTTTA AAGAATCAGGAGATTTGGAAAGCAAAGATACTTGAAGCTGAAGAGAGGGAGAAAAAGACT TTGAAACTAAAGGATGATAAAATTAGCGACTTAGAAGAGCAGCTTAGGGATTTGATGCTT TATCTTGAGACTGGGAAGACAGTGGAGCAGCCATCGATATCAAATGAAATAAAGGATGGC ACTGCCTTGCCAGCATCGATAGAGTTTTCGCGGCCATCAAGTAGCAAATGA
PEP MSPSSSTAHAGASPGEVFRSQPVIISGDPSDSSYSSSSSISNITQAFPFSSGNPRIEETR GIMLLYRDDADVVSTSPSHLPVGRKPLVCVLGVPNHMTYADFCQFCGSFIQHILEMRIVR NDGMEDRYSILIRFDSQDSTDDFYKHFNGSRFSSLEVEACRILFTVDVQYTGSIEHAQAS SGSSTEQPSCPVCLAAVYDLATAFVLQICYVHFPASVCRYCQQQPEKSNCFVCQTSENLW MCVICGFVGCGRYKEGHAIRHWKDTEHCYSLELETQRVWDYAGDNYVHRLIQSKTDGKLV ELNSPYNECGSCECVDSGFSEALLNSKVEAIVNEYNELLATQLENQKVYFELLLQEVKEE TEREISNAVEKAVPLKKMQAKLDRCVKEKKFLDDLNENLLKNQEIWKAKILEAEEREKKT LKLKDDKISDLEEQLRDLMLYLETGKTVEQPSISNEIKDGTALPASIEFSRPSSSK


| Top |