Cherry SNP DataBase

Gene information

Gene Pav_sc0000257.1_g710.1.mk
Chromosome name PAV_r1.0chr1
start 38001620
end 38003645
PAV_r1.0 name Pav_sc0000257.1
start 410878
end 412903
direction +
Annotation NR PREDICTED: dihydrofolate reductase
Sequence CDS ATGATGATATCTCAATTTCGTTGGTCCGCTGCTGCCGTTCACATTGAACGAGGCAGATTC CCACACGACGTCGTTCCAGTCAACAATAATTGCCTCAAACCTTCGCCATTTAAATTCAGC TACCCCACTCAAAATCCACGCACATTTCATTCCTCCAATACTAGCGGAACTGACAAGAGG AAGAAGAAGAAGAAAAAAAAACTCATCGAACCATTGGCATATTCTTCTTATTATTATTAT TACAGAAAAACCCCAGAAAAATTAAGAAATTACATGGGTAGCCAGGGAAGCGAAGAAGTA GGGTCGTTTGTGAAGAAACCCAGATTTCTCTGCCTCCATGGATTCAGAACCAGTGGAGAA ATCATGAAGAAACAAGTGGGTAAGTGGCCTGAATCTGTGCTGCAGAAGCTCGACCTTGTT TATCTTGATGGGCCTTTTCCGGCCCTAGGTAAATCTGACGTTGAGGGCATTTTTGATCCT CCTTATTATGAGTGGTTCCAATTCAACAAGGAATTTTCTGAGTACACAAACTTTGACAAG TGTTTGGAATACATAGAAGATTACATTATAAAGCAGGGACCATTTGATGGGCTAGTTGGT TTTTCCCAGGGTGCAATATTGTCGGCTGCGCTGCCGGGGCTACAAGCGAAGGGGTTGGCA TTGACTAAAGTGCCTAAAATTAAATTCCTCATCATAATTGGAGGGGCCAAATTCAAGTCC CCAGCAGTAGCTGACGATGCCTATGCTTCTCCCATTCAATGCCCGTCCCTTCACTTTTTA GGAGAGACGGACTTCTTGAAGCCATATGGACTTGAGCTATTGGAACACTGTGTAGAACCT ACAATCATTCATCATCCCAAGGGTCATACAGTCCCTAGGCTTGATGAAAAGAGTTTAGAG ACCATGATGAGCTTCATTGACAAGATTCAAAAGGCATTGACTGAGAAAGACCAACAGTAA
PEP MMISQFRWSAAAVHIERGRFPHDVVPVNNNCLKPSPFKFSYPTQNPRTFHSSNTSGTDKR KKKKKKKLIEPLAYSSYYYYYRKTPEKLRNYMGSQGSEEVGSFVKKPRFLCLHGFRTSGE IMKKQVGKWPESVLQKLDLVYLDGPFPALGKSDVEGIFDPPYYEWFQFNKEFSEYTNFDK CLEYIEDYIIKQGPFDGLVGFSQGAILSAALPGLQAKGLALTKVPKIKFLIIIGGAKFKS PAVADDAYASPIQCPSLHFLGETDFLKPYGLELLEHCVEPTIIHHPKGHTVPRLDEKSLE TMMSFIDKIQKALTEKDQQ


| Top |