Cherry SNP DataBase

Gene information

Gene Pav_sc0000257.1_g780.1.mk
Chromosome name PAV_r1.0chr1
start 37950061
end 37951311
PAV_r1.0 name Pav_sc0000257.1
start 463212
end 464462
direction -
Annotation NR hypothetical protein PRUPE_ppa011180mg
Sequence CDS ATGACAAGCAGCAAAGGAACCACAGCAGCAGCAGCAGCAGCCGCCCAACCAACCCATGAG TGCTGCATGTGTGGGGATTTTGGCTTCTCCTATGAGCTCTTTCAATGCAAGGTTTGCCAA TTCAGATCTCAGCACAGGTACTGTAGCAATCTTTACCCAAATGCAGAGTCTTACAGAATT TGCAATTGGTGCCTTACCCAGAAGGAGGACACAAAAGAAAAGTCCCAAAATTCCTCAAAC TCTTCATCTTCATGCAGAAAAGAAGGCCAAGATCATGACCCAACCAAGATCAACAAGAAA AAGAACTCATCAAAAACCAGTGATCATCAGAACAAGCAGGGGCATGGAGGTAATTCATAT GGGGGTCTAAGGGGCACCATGCAGCTGCAGCCAAGTGGCCCTATAAAGAAACAGAGATCA CTTGATCCTCATCATAATCATCAGGGTTTTGGATCACCATCTCCATCTCCATCTCCATCT CCAAAATCTCCATCCACCAGAAAGAGGATCCTCACAAATGGGCAGAAGGAGGCTGAGAAG ATTAGGAGGACAAGGTCAGAGGAGATATCAAACTTAAACAATCGGATCATTACAAGGCAG GTCTTTAGGAACAAGGTGAGAAGGTACAAGCTTTTGGATGAGGTTTCAAGTCAATGA
PEP MTSSKGTTAAAAAAAQPTHECCMCGDFGFSYELFQCKVCQFRSQHRYCSNLYPNAESYRI CNWCLTQKEDTKEKSQNSSNSSSSCRKEGQDHDPTKINKKKNSSKTSDHQNKQGHGGNSY GGLRGTMQLQPSGPIKKQRSLDPHHNHQGFGSPSPSPSPSPKSPSTRKRILTNGQKEAEK IRRTRSEEISNLNNRIITRQVFRNKVRRYKLLDEVSSQ


| Top |