Cherry SNP DataBase

Gene information

Gene Pav_sc0000258.1_g060.1.br
Chromosome name PAV_r1.0chr0
start 8664915
end 8668122
PAV_r1.0 name Pav_sc0000258.1
start 24635
end 27842
direction -
Annotation NR hypothetical protein PRUPE_ppa016948mg
Sequence CDS ATGTACCTCCCCTTGAATACTAATACTTGGAAACAGTGGACATGGATACTTGGATACATG GAAATGGATAGCTGGTTAGTCTGCATGCGTAGGATTTGTCACAAGCGCACGAGTATTGAG GATTCTACTGTGTGTGCTCTTTCGCCCAGTCCCCCGGGTGGACGGCTCGTCCCTGGCCAT ATGGGTGTTGAGGATTCCTCCATATGGTCTAGTCAAACGATCCCCGGATTGGATTGTCTT CCTCTGGTACATGATGATGGTGTGAGGGGGGGACTTTGCCGAAATTTCAGCAAAAAGTCT CGTTTCTCTTCCATAATTTGGAAGAGAGACTATGACGTTAGTAAGTGGGCTCGACATCAG TTTGATTTTGGAAATACCACCGGATTTGTCTCGGGTTCCGAGGAATTCGGGGCGGGTCCT GTCATTTTGGTATGGGCGTGCGAGTACTTGAAGCCACTTACTTTAAGTCGACCATTTACC TATGAAAACAGTCAATGGCCGCACGCGTTACGGTGGTTGGGTGACCCAGATGTGCGAGAA ACATCCCACAACTTGGAGCAGTTTAGGATAACTATGAGATATATCACTACTAATCAAGTC AATTGGCGTCCATGGGGAACTGATGATACAACCCTACAACATTATGTGCAAAGCAGCATT CCAGCTACAAAATAA
PEP MYLPLNTNTWKQWTWILGYMEMDSWLVCMRRICHKRTSIEDSTVCALSPSPPGGRLVPGH MGVEDSSIWSSQTIPGLDCLPLVHDDGVRGGLCRNFSKKSRFSSIIWKRDYDVSKWARHQ FDFGNTTGFVSGSEEFGAGPVILVWACEYLKPLTLSRPFTYENSQWPHALRWLGDPDVRE TSHNLEQFRITMRYITTNQVNWRPWGTDDTTLQHYVQSSIPATK


| Top |