Cherry SNP DataBase

Gene information

Gene Pav_sc0000290.1_g040.1.mk
Chromosome name PAV_r1.0chr1
start 8860284
end 8867080
PAV_r1.0 name Pav_sc0000290.1
start 11061
end 17857
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103322922 isoform X1
Sequence CDS ATGGTATGCTCACTTGGAAGTGGGAGGATGGCAGTGATGGCAAGGCTTCTTGCATCGGGG AGTGTCACACAAAGCATAGCAGAGGAAGTTGGCCATCAGAAGTTTGATGCTCAAATGATT TGCAGAGAGTTAAGTGACGCAAATGAAGCAAATTTGCTTGACGAAGAAGATATGAATGTG TTTGGTTTGAAGCCGATGGATGATCCTTTGCGTTTGGTATGTTGCAATGCTTGTAAAAGA CCAGTCAAGGCCAGTCAATATGTGGCACATGCAGAACTTTGTAGGTCATTAAATGCTATG CAAGAAACTACTTTGGAGCCTGATGGAAGTATGGGACAAAGGAAGCCTCCAAGGAAGGAG AAGAAAAAGTTGTTAACTGCTTATGCTAACCAGTCCACATCAGTTGGGGAGCTAGAAAGA TCTGAGTCTGTAGAAGCAGATGATATTGCTGTATCACAACCCCAGTTGGATGGGCAAATC GGAATGAATTCTTGCTGTTTTATGGAGACAAAAAGGAATTCAGCTTATGTAGATGCGACA TATATGATGGATGGTTCAGGAGATAGTCCTGGAAATACCAATGGCTCAAAATGTGTGATG CTTCCTCCAACAAAACGGTCTAAAATAGAAATGGACTCTCAGTGGCTTTATATGTCCTAT AGTGGTGTAGAATGTCCAGATAATAAGCGCTTAGGCATGCGATCTAGGGTAGCAGGTGAG CAGCTGCCACTATCAGATGATATAGGAATAGTATCTGCTGTATCAAAGCTTACAAGTACT CAGGACGCATGCCCCTATAGGGATTCTTCAAAAGGAGTCATTTCTGTAAGTGAAATACCT GATGACTCTGCCCTTAAATATAAGAAGTCTGGGCAAGCCCTTGAATGCTGCATGCCAATT AAAGATTGCCCTCTTCCCCTTGCTACTAAAGTATATTACTCTCAAAAAAGCAATCGTCTT CGATCAGCACTTTGCCATCTTTACTACGAGGCAGTGGCATCAACTAAGGGGCTGTGTAGT GACATGAGAGACTCACAGTCTTTACCTTCCATGAGGAAACCTGATCAAATTCTTGCACAA AATTCGGAAGTTTGCTTGGGGAACTCAGTAGGTTCCCTTCCTGATGGCGACTTCTCAAAT CAGTTTCCTGTTGATAATGTTCCAAGGCCTCAGGTTGCTGGTGTTGGTTTAACAAGAAGC AAAATTCTTTCAAAACCTTATTCTTTTGCGGGTAACTCAGGTATTCTTTAA
PEP MVCSLGSGRMAVMARLLASGSVTQSIAEEVGHQKFDAQMICRELSDANEANLLDEEDMNV FGLKPMDDPLRLVCCNACKRPVKASQYVAHAELCRSLNAMQETTLEPDGSMGQRKPPRKE KKKLLTAYANQSTSVGELERSESVEADDIAVSQPQLDGQIGMNSCCFMETKRNSAYVDAT YMMDGSGDSPGNTNGSKCVMLPPTKRSKIEMDSQWLYMSYSGVECPDNKRLGMRSRVAGE QLPLSDDIGIVSAVSKLTSTQDACPYRDSSKGVISVSEIPDDSALKYKKSGQALECCMPI KDCPLPLATKVYYSQKSNRLRSALCHLYYEAVASTKGLCSDMRDSQSLPSMRKPDQILAQ NSEVCLGNSVGSLPDGDFSNQFPVDNVPRPQVAGVGLTRSKILSKPYSFAGNSGIL


| Top |