Cherry SNP DataBase

Gene information

Gene Pav_sc0000293.1_g160.1.mk
Chromosome name PAV_r1.0chr3
start 480221
end 484102
PAV_r1.0 name Pav_sc0000293.1
start 69409
end 73290
direction -
Annotation NR PREDICTED: probable inactive receptor kinase At1g48480
Sequence CDS ATGAAGTCCCCAAAGCAGCGCAACATGGTTTTCACCACTTTGTTGCTGATATATAGTCTT GGCCTTTGCCTGATTGAGAGTTCTGATCTGGCTGCAGATAGAGAGGCCTTGTTGGCTCTC AGAACAGCCGTTAAAGGCCGTACAATGGAGTGGAACGTAACGGAGACCAACCCATGTTCA TCATGGCGTGGCGTTACATGTGAGTCAGGCCGAGTCACTGAGTTGAGGCTTCCGGGTCGG GCACTCGTTGGGCGACTCCCTCCGGGTCTCGGCAACCTGACCCAACTTTCGACCCTCTCT CTACGCCTAAACGCGCTTTCAGGCCAAGTCCCAAATGATCTCGTCAACCTCGTCAACCTC AAAAATCTCTACTTGCAAGGTAACTCATTCTCGGGTCCGATTCCAGAATTTTTGTTCAAT ATGCAAAGCCTTATGAGATTGAACCTTGCTAAAAATAATTTCTCTGGGGAAATTTCGTCG GGGTTTAATAAGTTGACGAGTTTGGTAACTCTGCATTTGGAAGAGAATCAGCTTACTGGG TCAATTCCTGAACTGGGTTTGGCCCTTGGACAATTCAATGTTTCGTTTAACCAGTTAAAC GGGTCGATCCCTTCAAAGTTTTTGGATTTGCCCGGAAGCGGTTTCGTGGGAAATTCGCTT TGTGGGAAGCCATTGAAGGCCTGTAATGGGACAGAGAATACTGGGAAGAAGCACAAGTTG TCTGGTGGAGCAATTGCAGGGATTGTGATTGGTTGTATTTTTGGTCTCTTCGTTATTATT GCCATTGTGATCTTTTTGTGTAAGAGAAATAAAAATGGTGAAGAGGGTACAGAGTATGTT GCTCCAGCGAAGGTTCGGGAAGTTGAAACCGCCAGTGGAAAGACAGGGGTGGATAGTGAG AGTTTGAGTACTGATTTCTCGGCTGCGTCCAAAGGGAATGTGAAGAGTGGTGGTGGGAGT AAGAGTTTGGTGTTTTTCGGGGATGCAGTGAAGGTGTTTGATTTGGAGGATTTGTTGAGG GCATCGGCCGAGGTGCTTGGGAAGGGGACTTTCGGGACTACCTATAAGGCGGCTTTGGAG TTGGGGGTGTCCATGGCAGTGAAGAGGTTGAAGGAGGTGACTGTACCGGAGAATGTATTT AGGGAAAAGATTGAAGAAATTGGGGGAATGGATCATGTGAATTTGGTCCCACTGAGGGCT TACTATTACAGCAGGGATGAGAAGCTTCTTGTGTATGATTACATGCCTATGGGAAGCTTA TCTGCTCTTTTGCATGGAAACAGAGGCGCTGGAAGGACTCCATTGAATTGGGAAACAAGG TCTGGCATTGCTGTTGGAGCTGCTCGTGCAATTACATACCTACATTCTCATGGTCCTACG ATCTCACATGGAAACATTAAATCTTCAAACATTCTTCTCACTAGATCCTTTGAAGCATGT GTCTCTGATTTTTGCCTTGCTCATCTTGCAAGCCCAACCTCTACTCCCAACCGCATTTCT GGTTATCGTGCTCCAGAACTCACCGATGCTAGCAAAGTAACCCAAAAAGCAGATGTTTAC AGCTTTGGTGTATTGCTTTTGGAGCTGCTTACAGGAAAGGCTCCAACCCAAGCTATCATG AATGAGGAAGGAGTAGACCTTCCAAGATGGGTTCACTCTGTCGTCCAAGAGGAGTGGACT GTTGAGGTGTTTGACCTCGAGCTTCTCAGGTACCAGAATGTTGAGGAGGATATGGTTCAA CTTTTACAGATTGCACTTGAATGTACCGTTCAGTACCCTGAGAATCGCCCTTTAATGGGC GAGGTAACTAGCCGAATTGAGGAGCTTTATAGTGCCAGCTTAAAGCATGGACAAGATGCA AATCCTGATATATCTCGTGATGTGGATGATGGGCTTTCTCAGCAGTATTTCTCAGCTGAC TCTCATATACGTCCATAA
PEP MKSPKQRNMVFTTLLLIYSLGLCLIESSDLAADREALLALRTAVKGRTMEWNVTETNPCS SWRGVTCESGRVTELRLPGRALVGRLPPGLGNLTQLSTLSLRLNALSGQVPNDLVNLVNL KNLYLQGNSFSGPIPEFLFNMQSLMRLNLAKNNFSGEISSGFNKLTSLVTLHLEENQLTG SIPELGLALGQFNVSFNQLNGSIPSKFLDLPGSGFVGNSLCGKPLKACNGTENTGKKHKL SGGAIAGIVIGCIFGLFVIIAIVIFLCKRNKNGEEGTEYVAPAKVREVETASGKTGVDSE SLSTDFSAASKGNVKSGGGSKSLVFFGDAVKVFDLEDLLRASAEVLGKGTFGTTYKAALE LGVSMAVKRLKEVTVPENVFREKIEEIGGMDHVNLVPLRAYYYSRDEKLLVYDYMPMGSL SALLHGNRGAGRTPLNWETRSGIAVGAARAITYLHSHGPTISHGNIKSSNILLTRSFEAC VSDFCLAHLASPTSTPNRISGYRAPELTDASKVTQKADVYSFGVLLLELLTGKAPTQAIM NEEGVDLPRWVHSVVQEEWTVEVFDLELLRYQNVEEDMVQLLQIALECTVQYPENRPLMG EVTSRIEELYSASLKHGQDANPDISRDVDDGLSQQYFSADSHIRP


| Top |