Cherry SNP DataBase

Gene information

Gene Pav_sc0000293.1_g560.1.mk
Chromosome name PAV_r1.0chr3
start 743683
end 748298
PAV_r1.0 name Pav_sc0000293.1
start 332871
end 337486
direction -
Annotation NR PREDICTED: E3 ubiquitin-protein ligase MARCH2
Sequence CDS ATGCAATTAGTATCAAATGATAGTCGCAAGGAAGATATTACAGAATGTGAGCCCATCTTA TGTCAGTCGGATATTTCACAGAGACCCACAGAATCTTCATCCTCATGTGAAATTACAGCT GTGCAAGGTGATTTTGCTGCTAATGATGAAGAGTCACAAAATCTAGACGTCGATGAAAAT TCGAAGTTGGTGAATCCCGAGCACCCACAATGCCGTATTTGCCTTGATACTGAAGAAGGG GAAGACTTAATTGCTCCATGCCATTGCAGAGGTACTCAGAAGTATGTCCATAGATCATGT CTTGATAATTGGAGGTCAACAAAGGAGGGCTTTGCTTTTGCTCATTGTACAGAATGCAGG GCAGTGTTCATATTACGAGCAAATGTCCCTCCCGACCGCTGGTGGTTGAGATTGAAATTC CAGTTCCTTGTTGCTAGAGACCATGCATTTATTTTCATTATCGTGCAGCTGATTGTGGCA TTCTTGGGAGTGATGGTATACAAATTTTATGGAGATGAACTAAGGGAGATGTTTGGTTAC GAGGAGCACCCATATGGGTTTTACACTATGGCTGTTTTAGCTATTGTTTTGGTGGGGTTG CTTTACGGCTTCTTCATAGCCATAATATGTGGACAGAGAATCAATGAACGGCATTACCAT GTTCTTGCCAAACAAGAATTAACAAAGGAATATGTTGTAGAAGACCGAGAAAATAATAAG AATGCCCCCGAGTTAGACCCCAGCCATGTGACAGAGCTAAGAATGTTGGGCCTTTATTAG
PEP MQLVSNDSRKEDITECEPILCQSDISQRPTESSSSCEITAVQGDFAANDEESQNLDVDEN SKLVNPEHPQCRICLDTEEGEDLIAPCHCRGTQKYVHRSCLDNWRSTKEGFAFAHCTECR AVFILRANVPPDRWWLRLKFQFLVARDHAFIFIIVQLIVAFLGVMVYKFYGDELREMFGY EEHPYGFYTMAVLAIVLVGLLYGFFIAIICGQRINERHYHVLAKQELTKEYVVEDRENNK NAPELDPSHVTELRMLGLY


| Top |