Cherry SNP DataBase

Gene information

Gene Pav_sc0000296.1_g130.1.br
Chromosome name PAV_r1.0chr4
start 16638202
end 16642323
PAV_r1.0 name Pav_sc0000296.1
start 83408
end 87529
direction -
Annotation NR PREDICTED: indole-3-acetate O-methyltransferase 1-like
Sequence CDS ATGGCTTCCAAGGGAGACAATGTCATAGGTTCAAGTATAAAGCTCGAGAAGATACTAAGC ATGAAAGGAGGCAAAGGAGAGTTAAGCTATGCTAAAAATTCCAAATCCCAGGCCGAACAT GCAAGATCCATGCTTCCCCTGCTTAAAGAAACCCTAGACAGAGTGCAACTGAGCTCTCGA GACGCCCCCTTTGTGGTTGTGGACCTTGGATGCTCAAGTGGAAGCAACACCATCTACATC GTAGACGTGATCATCAAACACATGGCCAAGCGCTATGAGTCCTTGGGATATCACCCGCCT GAGTTCTCGGCCTTTTTCTCTGATCTCCCTAGCAATGACTTCAACACCCTCTTCCAGTTC CTCCCTCCTATGGCCAACCACGGTGGTAGCATGGAGGAGACCGTCGCAGCCAACATCCAC CGCTCCTACTTTGCTGCAGGGGTACCCGGCTCCTTCTACCGGCGACTTTTTCCTTCAAGG TCCATTGACGTTTTTCACTCGGCGTTTTCTTTGCATTGGCTCTCACAGGTGCCAGAGAGT GTGCTAGACATGAAATCAGCAGCCTACAACAAAGGAAGGGTGTTTATTCATGGAGCAAAT GAGAGCACAGCCAATGCATACAAGAAGCAGTTCCAGACAGACTTGGCAAGCTTTCTCAAG TCAAGAGCCAAGGAGCTCAAGAAAGGTGGCTCTATGTTTCTTGTCTGTTTAGGCAGGACC TCAGTGGACCCCACTGACCAAAGTGGCCTAGGCCTTCTCTTGGGGACCTACATTCAGGGT GCTTGGGATGATCTTGTCCAAGAGGGTCTTATCAATAGTGAGAAACGTGACAGTTTCAAC ATTCCAGTGTATGCTTCAAGCTTACAAGATTTCAGAGAAGTAGTGGAAGCTGATGGCTCA TTCACCATAAATAAGCTTGAGATTTTCAAAGGAGGAAGCCCCATTGTAGTCAACCAACCA GATGATGCAGCTGAAGTTGGTCGAGCCCTTGCCAACACTTGTAGGAGTGCGACTAGAGTG CTCATTGATGCACACATAGGTGAGCACCTTGGCAATGAGTTGTTTTCAAGAGTGGAACAA AGGAGCTCAAGACATGCCAAAGAGCAACTGGAGCATATACAAATGTTTTACATAGTGGCA TCACTTTCTCTTGCTTAA
PEP MASKGDNVIGSSIKLEKILSMKGGKGELSYAKNSKSQAEHARSMLPLLKETLDRVQLSSR DAPFVVVDLGCSSGSNTIYIVDVIIKHMAKRYESLGYHPPEFSAFFSDLPSNDFNTLFQF LPPMANHGGSMEETVAANIHRSYFAAGVPGSFYRRLFPSRSIDVFHSAFSLHWLSQVPES VLDMKSAAYNKGRVFIHGANESTANAYKKQFQTDLASFLKSRAKELKKGGSMFLVCLGRT SVDPTDQSGLGLLLGTYIQGAWDDLVQEGLINSEKRDSFNIPVYASSLQDFREVVEADGS FTINKLEIFKGGSPIVVNQPDDAAEVGRALANTCRSATRVLIDAHIGEHLGNELFSRVEQ RSSRHAKEQLEHIQMFYIVASLSLA


| Top |