Cherry SNP DataBase

Gene information

Gene Pav_sc0000299.1_g150.1.mk
Chromosome name PAV_r1.0chr3
start 19725913
end 19728109
PAV_r1.0 name Pav_sc0000299.1
start 75134
end 77330
direction +
Annotation NR PREDICTED: putative auxin efflux carrier component 5
Sequence CDS ATGATTTCTCTAGCTGATGTCTATCATGTTGTGGCAGCCACTGTCCCTCTATATGTTGCC ATGATTTTAGCCTATGTTTCTGTGAAATGGTGGAAGCTCTTCACACCAGATCAATGTTCT GGCATAAACAAGTTTGTGGCAAAATTCTCAATCCCTCTCTTGTCATTTCAAGTGATTTCT GGGAATAACCCCTACAAAATGAACCTCAAACTCATTCTCTCTGACTGCCTACAAAAACTA ATTGCTTTTCTAGCATTGACAGCAATCACTAAATTCAGCTCCCATGGAGGCTTGAATTCG ATCATAACCGGTCTCTCTCTGTCAACTATGCCTAACACATTAATCTTGGGAATTCCTCTG TTAAAGGCCATGTATGGGGATGAAGCAGCCATGCTTGTTACTCAGATAGTTGTGTTACAG AGCTTAATCTGGTACAATATGTTATTGTTTCTCTTTGAGTTCAGGGCTGCTAAGGCAGCC TCTGTGACACCTTCATCAGAATCCACTGCAGAGGAGATGGAAGCCCCTCAAGAAGCACAA TCCAAAGAGGAAGCGGAGGATGAAACAAGAAGCAGAACTCCTAAGAAAATCAAATCTATC CTCTTAACAGTTGGGAGGAAGCTTATAGCCAACCCCAACACACATGCAACATTGTTGGGT CTAATTTGGGCAAGCATACACTACAAGTGGGGGGTGAAACTGCCAGATATTGTCACACAA TCAATTGCAATACTGTCAACTGGAGGACTTGGTATGGCAATGTTCAGCTTAGGCCTTTTC ATGGCATCGCGTGGCAGCATAATAGCATGCGGGACACGAACGGGGATGCTAGCCATGGGA TTGAAGTTCATGGCCGGGCCTGCGCTAATGGCAGTGTCCTCCTTTGCAGTTGGACTAAGA GGCAGAATTCTCAGAGTGGCAATTGTGCAGGCGGCTCTTCCTCAAGGAATCGTTCCATTC GTTTTCGCGAAAGAATATAATGTACATCCAGACATTTTGAGCACCGGGGTTATATTTGGG ATGCTCATTGCCTTGCCAATAGCATTGGCCTACTACTTCCTACTGGGACTATAA
PEP MISLADVYHVVAATVPLYVAMILAYVSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQVIS GNNPYKMNLKLILSDCLQKLIAFLALTAITKFSSHGGLNSIITGLSLSTMPNTLILGIPL LKAMYGDEAAMLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPSSESTAEEMEAPQEAQ SKEEAEDETRSRTPKKIKSILLTVGRKLIANPNTHATLLGLIWASIHYKWGVKLPDIVTQ SIAILSTGGLGMAMFSLGLFMASRGSIIACGTRTGMLAMGLKFMAGPALMAVSSFAVGLR GRILRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPIALAYYFLLGL


| Top |