Cherry SNP DataBase

Gene information

Gene Pav_sc0000299.1_g230.1.mk
Chromosome name PAV_r1.0chr3
start 19756743
end 19762960
PAV_r1.0 name Pav_sc0000299.1
start 105964
end 112181
direction -
Annotation NR H(+)-transporting atpase plant/fungi plasma membrane type, putative
Sequence CDS ATGGCTGAGATGGATGGAAAATCTGAAGCTTTGGACGCCGTATTGAAGGAAGCTGTGGAT TTGGAGAACGTGCCTCTTGAAGAGGTTTTTCTGACCTTGAGGTGCAACAGACATGGGCTC ACATCTGAGGCTGCTGAGCAAAGGTTGGTCATTTTTGGGTACAACAAGCTTGAGGAGAAG AAGGAAAGTAAGGTTTTGAAGTTTTTGGGGTTTATGTGGAACCCTCTGTCATGGGTGATG GAAGCTGCAGCTATCATGGCCATAGCGCTTGCCAATGGAGGATCTGCACTTACAGGCGAG TCACTTCCTGTGACAAAAGGCCCCGGCGACAGCGTGTATTCGGGTTCAACGTGCAAACAG GGAGAGATTGAAGCAGTGGTAATTGCCACCGGTGTTCATACCTTTTTCGGTAAGGCTGCT CACCTGGTGGACACCACGAATCAACAGGGCCACTTTCAAAAGATTTTGAATCTTGTACAC AATAAATCAGAGATAGAACGTAGAGTTCATACTGTGATTGATAAATTTGCGGAGCGAGGT TTACGATCCCTAGCAGTAGCATACCAGGAAGTTCCAGATGGAAGGAAGGAGAGCCAGGGA GGGACTTGGCAATTTATTGGCCTCATGCCTCTGTTTGACCCGCCTAGACATGATAGTGCA GAGACAATTAGAAGGGCATTGAACCTTGGGGTTAATGTTAAGATGATTACAGGCGATCAA CTGGCAATAGCAAAAGAGACAGGACGCCGTCTAGGTATGGGAACCAACATGTATCCATCG TCCAGTCTGTTAGGACAGAACAAAGATGAGTCAATTGTTACTTTGCCAGTTGATGAACTT ATTGAAAAAGCTGATGGGTTTGCTGGTGTTTTCCCGGAACACAAGTATGAAATTGTCAAA CGATTGCAAGCCAGAAAGCACATATGTGGAATGACTGGCGATGGAGTTAACGATGCTCCT GCTCTTAAAAAAGCCGATATCGGCATAGCTGTCGCTGATGCAACTGATGCAGCTCGTAGC GCTTCCGACATTGTCTTGACAGAACCTGGCCTTAGCGTCATCATAAGTGCCGTATTAACC AGTAGGTCCATATTCCAGAGGATGAAGAATTACACGATATATGCTGTTTCCATTACAATC CGTATTGTGCTTGGTTTCATGTTGCTGGCACTCATATGGCAATTTGACTTCCCACCTTTC ATGGTGTTGATTATTGCAATTCTCAATGATGGTACCATCATGACGATATCGAAGGATAGG GTGAAACCCTCTCCTCTCCCAGACAGCTGGAAACTGTCAGAGATCTTTACAACTGGAATC ATCCTCGGTGGTTACCTGGCTATGATGACAGTCATTTTCTTTTGGGCAGCATACAAGACA AACTTCTTCCCTCGCACATTTGGGGTTTCAAGCCTCCAGAATAAGGGCGAGGACAACTAC AGGAAGCTTGCCTCGGCAGTGTACCTGCAAGTGAGCACCGTCAGTCAGGCCCTCATATTC GTCACCCGTTCCCGGAGTTGGTCTTTTGTTGAGCGTCCTGGTCTGTTACTTGTAGCAGCT TTTTTTATAGCTCAGCTGATTGCTACGCTGATCGCTGTCTATGCCAGTTGGAGTTTTGCT GCAATTGAGGGAATTGGGTGGGGGTGGGCTGGCGTGGTTTGGCTATATAACCTCGTCTTC TATTTCCCACTTGATTTTATCAAGTTCATTGCCTTCACGAGGAAGAAGGATTTCGGAAAG GAAGAAAGGGAGCTAAAATGGGCACATGCACAGAGGACCCTCCATGGGCTGCACCCACCA GAAGCCAATATATTCGCCGACCGCAGTAATTACACAGAACTGAATCAGATGGCGGAAGAG GCAAAGAGACGAGCTGAAATTGCCAGGCTGAGAGAATTAAGTACCCTGAAAGGGCATGTG GAATCAGTGGTGAGAAACAAGGGCCTGGACATAGACACAATTCAGCAATCATACACAGTC TGA
PEP MAEMDGKSEALDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEK KESKVLKFLGFMWNPLSWVMEAAAIMAIALANGGSALTGESLPVTKGPGDSVYSGSTCKQ GEIEAVVIATGVHTFFGKAAHLVDTTNQQGHFQKILNLVHNKSEIERRVHTVIDKFAERG LRSLAVAYQEVPDGRKESQGGTWQFIGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQ LAIAKETGRRLGMGTNMYPSSSLLGQNKDESIVTLPVDELIEKADGFAGVFPEHKYEIVK RLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLT SRSIFQRMKNYTIYAVSITIRIVLGFMLLALIWQFDFPPFMVLIIAILNDGTIMTISKDR VKPSPLPDSWKLSEIFTTGIILGGYLAMMTVIFFWAAYKTNFFPRTFGVSSLQNKGEDNY RKLASAVYLQVSTVSQALIFVTRSRSWSFVERPGLLLVAAFFIAQLIATLIAVYASWSFA AIEGIGWGWAGVVWLYNLVFYFPLDFIKFIAFTRKKDFGKEERELKWAHAQRTLHGLHPP EANIFADRSNYTELNQMAEEAKRRAEIARLRELSTLKGHVESVVRNKGLDIDTIQQSYTV


| Top |