Cherry SNP DataBase

Gene information

Gene Pav_sc0000299.1_g290.1.mk
Chromosome name PAV_r1.0chr3
start 19794690
end 19799878
PAV_r1.0 name Pav_sc0000299.1
start 143911
end 149099
direction +
Annotation NR PREDICTED: pleiotropic drug resistance protein 3-like
Sequence CDS ATGGATTTGGCAGCAGAGATAGGAAGAAGCGTGAGGACCTCTTTTCATCACCATGCATCG AGTTTCAGGAGCACTTCAGACGTCAGATCCATCAACGACAACAACGACGATGAAACTGAG TTGCAGTGCGCTGCAATCCAACGGTTGCCCACATTTGAACGACTTACTGATGAGCAAGAT AACAATGGAGGAGGTGCTATTAGTAAGAGGGTGGTTGATGTTACAAAGCTAGGAGCCCTC GAACGCCACGTGTTCATTGAGAAACTTGTCAAGGATATTGAGGGAGATAACCACCGTCTG TTGCAGAAACTCAAACAAAGAATAGACAGGATGACTCTATTGCTTGGTCCTCCAGGCTGT GGGAAAACCACTTTCTTACAGGCACTTGCAGGGAAACTTAACGACTCTCTCAAGAAGCTT TTTTTCTCCATTCAAGATATAATGAAAGAAGTCAGCAGAAGGGAGAAGCAATCAGGAATT GTCCCAGAACCAGACATTGACACTTATATGAAGATTCTTGGGCTAGACATTTGTGCTGAT ACAATCGTAGGCAATGCGATGCAAAGAGGAATTTCGGGTGGTCAGAAGAAAAGACTGACA ACAGCTTCTTTGCCTGCTTGGTTGGAGTGGGGCTTCTGGCTTTCTCCACTAACATATGGA GAAATAAGTGCTTCAGTAAATGAATTTCACGCTCCAAGGTGGCAAAAGGTTTTATCTTCA AATGTCACTGTAGGCCAGCAAGTTCTGGAAAACCGTGGTCTCAATTTCAGTGACAGCTTT TATTGGATATCAATAGGAGCTTTACTTGGATTTTGGATGGTTTTCAACATTGGGTTCACC TGTGCACTCAGTTATTTAAAATCTCCTGGAAGTTCTCAAACTATCATTTCTCATGAAAAA TTCTCTCATCTGAAGGAAAAAGAAAATTTAGATAATTCCTGCCAAGAAAAAGAATTAACT TGTGTAGATACTCACATAACTGCTGCAGAAGCTACAAGTATAGGCATGGTCTTACCCTTT GAGCCCATAAGTATATCATTTCAGAATGTGCAATACTTTGTTGATACACCCAAGGTGAGT ACATTCTTTATGCGTTCCTGA
PEP MDLAAEIGRSVRTSFHHHASSFRSTSDVRSINDNNDDETELQCAAIQRLPTFERLTDEQD NNGGGAISKRVVDVTKLGALERHVFIEKLVKDIEGDNHRLLQKLKQRIDRMTLLLGPPGC GKTTFLQALAGKLNDSLKKLFFSIQDIMKEVSRREKQSGIVPEPDIDTYMKILGLDICAD TIVGNAMQRGISGGQKKRLTTASLPAWLEWGFWLSPLTYGEISASVNEFHAPRWQKVLSS NVTVGQQVLENRGLNFSDSFYWISIGALLGFWMVFNIGFTCALSYLKSPGSSQTIISHEK FSHLKEKENLDNSCQEKELTCVDTHITAAEATSIGMVLPFEPISISFQNVQYFVDTPKVS TFFMRS


| Top |