Cherry SNP DataBase

Gene information

Gene Pav_sc0000304.1_g090.1.mk
Chromosome name PAV_r1.0chr2
start 839043
end 846040
PAV_r1.0 name Pav_sc0000304.1
start 85628
end 92625
direction +
Annotation NR PREDICTED: pentatricopeptide repeat-containing protein At3g61360-like isoform X1
Sequence CDS ATGCTTCATCTTCGCTTCCCGATTTTTGCCGTCTTTGCCATCATAGGAGTTGTGTTCTCC GGTGAAATCCATGTGGCCGTAGGGCAGCTATGTGGCGGTGACGTTGGAGGTCTTATAAGG CAATGCTCAACTTATGTGGAAAAGGGTAAGCCGATGACAAATCCATCTCAAGCATGCTGT GATTTGATAAAGAAGGTGGACATTCTATGTGCCTGCAAGCACGTGACCAAGGAGCTGGAG GAGTTGGTTGACATGAAAAAGGTGGTTCATGTCGTCTCCTACTGTGGCATACCTGTTCCT CATGGAATGAATGCAACCAAGGAGAGAATGCTCCTTTTGACAAGATTAAAGAGATCCAAT CAACTTACTCAAATTCCTCCAAAGCTAAATTTTTCTGTCATTCATGCTCTTAAAATATCC AGCCAATTTCTACCGTCTTCAGAAACTAATATTGAAGTTGACAGGATCACCAGAATAATT AATAACCATCCGTATCCTGATCAACCACTTCTACCAACTCTTCTCCAGCACATCCCACCC CATGCTCTTTCCACCAGCTTTGTGGAGAATGTTTTGGGTTACCTTTTCGCAGCCCATTCT AATGGTCTTAAAGCCCTTGAATTCTTCAATTATTCCCTCCATCATTCCCAGTTATGTCCA AGCTACGATGCTTTTGAAAAGACACTGCACATCCTTGCCAGGATGCGTTATTTTGATAAA GCTTGGGACTTGATGGAAAAAATAAGCAGCATGCACCCTTCCTTGCTTACCCTTAAGTCA ATGAGCATCATGCTGTCAAAAATTGCAAAATTTCAGTCATATGAAGATGTCCTTGAAGCA TTTGGCAAGATGGAGAATGATATTTTTGTTGGGAGGAAGTTTGGTACTGAAGAGTTTAAT GTACTCCTTAGAGCATTTTGCACGGAGAGGCAGATGAAGGAGGCACGTTCGGTGTTCCTA AAGATGCATTTTCGGTTTTCACCCAACACTAAGACCATGAATATCTTGCTCTTGGGATTC AAGGAATCTGGAGATATTACTGCAGTAGAACTCTTTTACCATGAACTGGTTAAAAGAGGC TTTGAGCCAAATATTATAACTTACAATATTAGAATCGATGCTTACTGTAAGAAAGGTTGC TTTGCTGATGGTTTGAGACTTTTTGAAGGAATGGAACGGGAAAATTTGTCTCCCACTTTG GAAACAATCACTACATTGATCCATGGAGCAGGGGTCGCTCGAAATCCAATTAAGGCACAA CAATTATTTGGTGAGATTCGTTTGAGAAATTTGCTTCCTGATACTGCGGCGTATAATGCT TTGATGAGTTCGCTTATTAGATCAAGAGATGTGAAGTCGGCAGTCGCATTGATGGATGAG ATGGAAGCGAAGCATATTGAACATGATTATATGACTTATCACACCATGTTCTCTTGCTTG ATGAGGACATCTGATATTGATGGTGTATCTAGACTATATCACAAAATGGTTGACAGAAGT TTTGTGCCCAAAACACGAACAGTGGTGATGTTAATGAAATATTTCTGTGTAAATCAGCAG CTTGATTTGGGATTGCATTTATGGCGATACCTGGTGGAGAAAGGATGTTGTCCTCATGGT CATGCTTTGGACCTTCTGTTAACGGGATTGTGCTCCCACAGTAGGGTAATAGAAGCTTTT GAGTGCTCCAAACAAATGTTGGAGAGAGGGAGAGATATGAGTGAACCTGCATTACGGATA TTAGAGAGCTTTCTGGTTCAGGCAGGTGAGATAGACAAGCTGAGGAAGATCAAGCTGATG ATACAGACATTGCATACTCTGTTGCCCCCATTAAGAGGGCACACTTTTGCTGATCCTGCA ACCAAAGGTACAGAGGTACACAAACCAGGTCCACAATGCAAAGTGTCATGA
PEP MLHLRFPIFAVFAIIGVVFSGEIHVAVGQLCGGDVGGLIRQCSTYVEKGKPMTNPSQACC DLIKKVDILCACKHVTKELEELVDMKKVVHVVSYCGIPVPHGMNATKERMLLLTRLKRSN QLTQIPPKLNFSVIHALKISSQFLPSSETNIEVDRITRIINNHPYPDQPLLPTLLQHIPP HALSTSFVENVLGYLFAAHSNGLKALEFFNYSLHHSQLCPSYDAFEKTLHILARMRYFDK AWDLMEKISSMHPSLLTLKSMSIMLSKIAKFQSYEDVLEAFGKMENDIFVGRKFGTEEFN VLLRAFCTERQMKEARSVFLKMHFRFSPNTKTMNILLLGFKESGDITAVELFYHELVKRG FEPNIITYNIRIDAYCKKGCFADGLRLFEGMERENLSPTLETITTLIHGAGVARNPIKAQ QLFGEIRLRNLLPDTAAYNALMSSLIRSRDVKSAVALMDEMEAKHIEHDYMTYHTMFSCL MRTSDIDGVSRLYHKMVDRSFVPKTRTVVMLMKYFCVNQQLDLGLHLWRYLVEKGCCPHG HALDLLLTGLCSHSRVIEAFECSKQMLERGRDMSEPALRILESFLVQAGEIDKLRKIKLM IQTLHTLLPPLRGHTFADPATKGTEVHKPGPQCKVS


| Top |