Cherry SNP DataBase

Gene information

Gene Pav_sc0000308.1_g250.1.mk
Chromosome name PAV_r1.0chr1
start 5296549
end 5302160
PAV_r1.0 name Pav_sc0000308.1
start 176331
end 181942
direction -
Annotation NR PREDICTED: xylose isomerase
Sequence CDS ATGAAAATGAAGGCTGGGAGGATATTGCTGCTTCTTCTTTGTTTGAGTGTGGTTACCTTT GGAGTGATTGCTGGTCCGCAAACATGTCCTGCATCGGATCTTGAAAGTGGGTGTAGTGAT TCGGAGGAATGGAGAGGGGAATTTTTCCCTGGAATTCCCAAAATTAAGTATGAGGGCCCG TCTAGCAAGAACCCCTTATCCTTCAAATGGTATAATGCGGAAGAGGAAATTCTCGGGAAG AAAATGAAGGATTGGTTGAGGTTTAGTGTTGCATTTTGGCACACATTCCGTGGAACGGGA GGTGACCCATTTGGTGCACCTACAAAGAATTGGCCATGGGAGGATGGAACTAATTCTGTG GCTATGGCCAAAAGAAGGATGAGAGCCAACTTTGAGTTCATAAACAAGCTTGGAGTCGAT AGGTGGTGCTTCCATGACAGGGATATAGCTCCTGATGGAGAAACTTTGGAGAAAGTACAG ATAACACAAAACTGGAAAGTGTTCATTTACCTTGTATGTTTGTTACAGGAATCTAACAAA AACTTGGATGAAGTGGTGGCCCTTGCTAAGGAGCTTCAGGGAAGCAAAATTCGACCTTTG TGGGGCACAGCTCAGCTGTTTCTGCATCCTCGCTACATGCATGGTGGTGCTACTAGCCCT GAAGTAGGTGTATATGCATATGCTGCTGCTCAAGTTAAGAAAGCCATTGAGGTCACAAAT TATTTAGGGGGCGAAAATTATGTCTTCTGGGGTGGCCGCGAGGGTTACCAGAGTCTCTTG AATACTGACATGGGACGAGAGCTTGATCATCTGGCACGGTTTCTTGAAGCTGCAGTTGCC TACAAGAAGAAAATTGGATTTAATGGGACACTCTTGATTGAACCCAAGCCTCAAGAACCT ACCAAACACCAGTATGATTGGGATGCTGCAACATCAGCAAATTTCCTCCGAAAATATGGC CTAATAGGTGAATTTAAACTTAACATTGAGTGCAATCATGCCACGCTATCTGGTCACAGC TGTCACCATGAGCTTGAAACTGCAAGACTCAATGGTTTATTAGGAAATGTTGATGCAAAC ACTGGAGATCCTCAGACTGGATGGGATACAGATCAATTTCTCACAGATATTGCAGAGGCA ACTCTGGTTATGCTCACTGTAGTAAAGAATGGAGGAATTGCACCAGGAGGATTCAACTTC GATGCAAAATTACGGAGAGAAAGCACAGACGTTGAGGATTTGTTCATTGCTCATATTAGT GGAATGGATACCCTGGCGCATGGGCTCCGAAATGTTGTGAAGCTCATTGAGGATGGTTCT CTGGATGAGCTTGTTCGCAAGCGATATGAGAGTTTTGATACAGAAATTGGCGCACATATA GAGGCTGGTAAGGGTGATTTTGAGTATCTTGAGAAGAAGGCCTTAGAATGGGGTGAACCC AAAGTTCCTTCTGCCAAGCAGGAACTTGCGGAGATGCTTTTCCAGTCGGTTTTGTAG
PEP MKMKAGRILLLLLCLSVVTFGVIAGPQTCPASDLESGCSDSEEWRGEFFPGIPKIKYEGP SSKNPLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFGAPTKNWPWEDGTNSV AMAKRRMRANFEFINKLGVDRWCFHDRDIAPDGETLEKVQITQNWKVFIYLVCLLQESNK NLDEVVALAKELQGSKIRPLWGTAQLFLHPRYMHGGATSPEVGVYAYAAAQVKKAIEVTN YLGGENYVFWGGREGYQSLLNTDMGRELDHLARFLEAAVAYKKKIGFNGTLLIEPKPQEP TKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNVDAN TGDPQTGWDTDQFLTDIAEATLVMLTVVKNGGIAPGGFNFDAKLRRESTDVEDLFIAHIS GMDTLAHGLRNVVKLIEDGSLDELVRKRYESFDTEIGAHIEAGKGDFEYLEKKALEWGEP KVPSAKQELAEMLFQSVL


| Top |