Cherry SNP DataBase

Gene information

Gene Pav_sc0000308.1_g560.1.mk
Chromosome name PAV_r1.0chr1
start 5109445
end 5117299
PAV_r1.0 name Pav_sc0000308.1
start 361192
end 369046
direction +
Annotation NR PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial
Sequence CDS ATGGTGTATAATGGAAGAGGTTTTTTTCTTGATCCTCCGATGGTTTTTTTGTCCAACAAT ATGTGGAACCTTTCCTTACCTGAAGGGTTGCGTTCTTGGAGTCTGAATCTCAAAAATATG ACCTTTGGTTCCCGTGATGATATTTTTGTCAAGAGCAGGGACAAGTCAGATCTTGCTGTT ATACAAGGTGCTGGAGGAATGCATATGGTTGATCCACTTTTCCAGCGGGTTCTGGTGAAT GAGTGCCGGAAGAAAAATATTCCCACTATCTTTGATGAGGTTTTCACTGGTTTCTGGCGT CTAGGAACAGAGTCAGCCGCAGAACTACTATCTTGTTTTCCAGATATAGCCTGCTTTGGG AAGCTGATGACTGGTGGGACTGTACCCTTGGCTGCCACATTGGCTACCAATGCCGTATTT GACTCATTTATTGGAGACTCAAAGCTAAAGGCCCTTCTGCATGGACATTCATATTCTGCA CATGCTATCGGGTGCACAGCAGCTGCTAAATCCATAAGATGGTTTAAGGATTCTCAGAGA AATCCTAATATCACTTCCAAAGGAAGCTTACTTAGCGAGTTATGGGATGACAAACTAGTG TACCAGATCTCTTCACATCCTGCAATTCAAAGAGTAGTTGTGTTGGGAACGCTTTGTGCT CTAGAGCTCCGAGTAGAAGGCTGCAACGCTGGGTATGGGTCACGGTATGCAAGCTCTCTT CTGAAGAAGCTCCGTGAAGACGGAGTTTACATGAGGCCTCTGGGACATGTCATATATCTC ATGTGCGGACCCTGCACATCTCCTAAGGTCTGCAACGAAGCCCTCACTAAAGTTTACAGA AGGCTTGAAGAACTTAGCCCATCTCAAAACAATTAA
PEP MVYNGRGFFLDPPMVFLSNNMWNLSLPEGLRSWSLNLKNMTFGSRDDIFVKSRDKSDLAV IQGAGGMHMVDPLFQRVLVNECRKKNIPTIFDEVFTGFWRLGTESAAELLSCFPDIACFG KLMTGGTVPLAATLATNAVFDSFIGDSKLKALLHGHSYSAHAIGCTAAAKSIRWFKDSQR NPNITSKGSLLSELWDDKLVYQISSHPAIQRVVVLGTLCALELRVEGCNAGYGSRYASSL LKKLREDGVYMRPLGHVIYLMCGPCTSPKVCNEALTKVYRRLEELSPSQNN


| Top |