Cherry SNP DataBase

Gene information

Gene Pav_sc0000311.1_g1240.1.mk
Chromosome name PAV_r1.0chr7
start 18471147
end 18476979
PAV_r1.0 name Pav_sc0000311.1
start 629983
end 635815
direction +
Annotation NR PREDICTED: actin-related protein 6
Sequence CDS ATGCATCAAAACGTCGTCGTGTTGGACAACGGCGGCGGCCTAATCAAAGCTGGACTCGGC GGCGAGCGCGACCCCTCAGCCATAATCCCTAACTGCGTCTACCGCCCACTCTCCTCCAAG AAATGGGTGCACCCTTCACCCACCGAGCCCATGGACCTCACCTCCGCGGCGGTCCGGCGG CCCATCGACCGCGGCTACCTAATCAACCCGGATCTCCAGCGCGAGATCTGGGCCAACCTC TTCTCCTCCCTTCTCCGGGTCAACCCGGCCCAATCGTCCCTTCTCCTGACGGAGCCCCTC TTCACCCTCCCATCCATCCAACGCGCCACCGACGAGCTCGTCTTCGAGGACTTCAACTTC TCGTCGCTCTACGTGGCCCACTCTCCCTCCCTGGCCCACCTCTACGAGGCCAGCCAGCGG ACCTTTAAGGCCCAATGCAGCCTCGTCGTCGACTGCGGCTTCTCTTTCACTCACGCCGTC CCTGTTTTCCAAAACTTCCCCATCAACTACGCCGCTAAGCGAATCGACTTGGGCGGCAAG GCCTTGACCAATTACCTCAAAGAGCTTGTATCTTACCGCTCTGTCAATGTCATGGACGAG ACCTTCCTGATCGACGACGTTAAGGAGAAGCTCTGCTTTGTTTCCTTAGACGTTGCTCGT GACCTCCAGATCGCAAAGAAACAAGGGAAGGACAATGCTTTCAGGTGCACGTATGTGTTG CCTGATGGTGTTACGCACACAAAAGGGTTCGTTAAGAACCCAGAAGAGGCGCAGAGATAC TTGGCTTTGGGAAACGGTGACACACTTGAAGAAGTGCAGCAAAAGATGGATGTGGATCAG ATGGAAGTTACAAACAAGCTGGAGGATCGAAAGAAGATTGATTTAACCAAGAATGAATTT GACTTGACAAATGAAAGGTTCCTTGTGCCAGAGATGATCTTCCATCCTGCTGATTTGGGA ATGAATCAGGCTGGGCTAGCGGAGTGCATGGTTCGAGCTGTCAGTTCCTGCCATCCTCAT CTTCACCCTGTACTCTATGAAAAAGAGAGGGAGCTGCGGCCTCTTGTTCCTGATGACTAT CAAGTGAACATAACTCCTCAACAAGACCCCATACTAGGTGTTTGGCGAGGAGGATCTCTT TTAGCATCAAGTCCTGATTTTGAAGCAATGCGTGTCACCAAGGCTGAATATGAGGAACTT GGATCTGCTCGATGTCGCAGGAGATTCTGTTAA
PEP MHQNVVVLDNGGGLIKAGLGGERDPSAIIPNCVYRPLSSKKWVHPSPTEPMDLTSAAVRR PIDRGYLINPDLQREIWANLFSSLLRVNPAQSSLLLTEPLFTLPSIQRATDELVFEDFNF SSLYVAHSPSLAHLYEASQRTFKAQCSLVVDCGFSFTHAVPVFQNFPINYAAKRIDLGGK ALTNYLKELVSYRSVNVMDETFLIDDVKEKLCFVSLDVARDLQIAKKQGKDNAFRCTYVL PDGVTHTKGFVKNPEEAQRYLALGNGDTLEEVQQKMDVDQMEVTNKLEDRKKIDLTKNEF DLTNERFLVPEMIFHPADLGMNQAGLAECMVRAVSSCHPHLHPVLYEKERELRPLVPDDY QVNITPQQDPILGVWRGGSLLASSPDFEAMRVTKAEYEELGSARCRRRFC


| Top |