Cherry SNP DataBase

Gene information

Gene Pav_sc0000311.1_g650.1.mk
Chromosome name PAV_r1.0chr7
start 18800849
end 18801868
PAV_r1.0 name Pav_sc0000311.1
start 305094
end 306113
direction +
Annotation NR
Sequence CDS ATGGGGGGAAGACCAGGAGGATCAATTCGAGGTCAGGGTCAAGACCCACCTCCAGTGCTT CATCCTGTAACCAAGTTTTTGGATAAGAAGAATGATGAGGATCTCTGGATCCAGATTGTG AGGATAACGAACCTAAAGGAGGAGGAGAAGAAGAAGAAGAAGAAACAGTGTGCCAGCCTA TGGGTGTGTTTCACAGCAGGGACTAGTGGAAAAGAGATGCAAGGGGAAGCGCGGGACCAA AAAAAAGCCCACCAAGTCTATTAA
PEP MGGRPGGSIRGQGQDPPPVLHPVTKFLDKKNDEDLWIQIVRITNLKEEEKKKKKKQCASL WVCFTAGTSGKEMQGEARDQKKAHQVY


| Top |